Diaphorina citri psyllid: psy16076


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MLEKNVKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYINDLTK
cccccCEEEEccccccccccccccEEEEECccccEEEEccccccccccHHHHHHHHHHHcccccccEEEEEEccccccccccccccHHHHHccccccEEEEEECccccccHHHHHHccccccccccCEEEEEccEEEEccccccccccccccccccccccc
*****VKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYINDL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEKNVKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYINDLTK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045217 [BP]cell-cell junction maintenanceprobableGO:0009987, GO:0043954, GO:0034331, GO:0034330, GO:0016043, GO:0044763, GO:0071840, GO:0045216, GO:0008150, GO:0044699
GO:0017048 [MF]Rho GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0044295 [CC]axonal growth coneprobableGO:0044464, GO:0044463, GO:0030427, GO:0030426, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WMH, chain B
Confidence level:very confident
Coverage over the Query: 24-94
View the alignment between query and template
View the model in PyMOL
Template: 1NF3, chain C
Confidence level:confident
Coverage over the Query: 95-157
View the alignment between query and template
View the model in PyMOL