Psyllid ID: psy16076

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MLEKNVKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYINDLTK
cccccEEEEEccccccccccccccEEEEEEccccEEEEccccccccccHHHHHHHHHHHcccccccEEEEEEccccccccccccccHHHHHccccccEEEEEEEcccccHHHHHHHHcccccccccEEEEEEccEEEEccccccccccccccccccccccc
cHHHHcEEEEccccccccEEEEEEccccccccccEEEEEEccccccccHHHHHHHHHHHHccccccEEEEEEccccccccccccccHHHHccccEEEEEEEEcccccccccEEEEEcccccccccccEEEEEEEEEEEEccEEEEcccccccHHHHHHccc
mleknvkfishysypqgitTVYHKYNAftlsfdaefrrfsvpkpdistyNEFKILVEKLHhldeipfhltyiatdgdllpinndsnLGKALLNSFLRVSqiidvdvvpetcRRVRllkspnserplgfyirdgtslrvtstgldkflrisSSTKYINDLTK
MLEKNVKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRvrllkspnserplgfyirdgtslrvtstgldkflrissstkyindltk
MLEKNVKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYINDLTK
*****VKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRIS***********
**********HYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCR*VR*****NSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYINDL**
MLEKNVKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYINDLTK
MLEKNVKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYI***TK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEKNVKFISHYSYPQGITTVYHKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNSFLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKFLRISSSTKYINDLTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q9NAN2 309 Partitioning defective pr yes N/A 0.788 0.411 0.397 7e-25
Q9NPB6 346 Partitioning defective 6 yes N/A 0.701 0.326 0.357 7e-19
Q9JK84 382 Partitioning defective 6 yes N/A 0.701 0.295 0.373 4e-18
Q9BYG5 372 Partitioning defective 6 no N/A 0.701 0.303 0.365 6e-18
Q9JK83 371 Partitioning defective 6 no N/A 0.701 0.304 0.365 9e-18
Q9BYG4 376 Partitioning defective 6 no N/A 0.726 0.311 0.370 3e-17
Q9Z101 346 Partitioning defective 6 no N/A 0.701 0.326 0.321 1e-12
Q6B4M5 346 Partitioning defective 6 no N/A 0.701 0.326 0.321 1e-12
>sp|Q9NAN2|PAR6_CAEEL Partitioning defective protein 6 OS=Caenorhabditis elegans GN=par-6 PE=1 SV=2 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 92/186 (49%), Gaps = 59/186 (31%)

Query: 22  YHKYNAFTLS----FDAEFRRFSVPKPDIS--TYNEFKILVEKLHHLDEIPFHLTYIATD 75
           YH+ +  TL     FD+E+RRFS+P    S  +Y+ F+ LVEKLHHL+ + F L Y +T 
Sbjct: 7   YHQNHHSTLQVKSKFDSEWRRFSIPMHSASGVSYDGFRSLVEKLHHLESVQFTLCYNSTG 66

Query: 76  GDLLPINNDSNLGKALLNS----------------------------------------- 94
           GDLLPI ND NL K+  ++                                         
Sbjct: 67  GDLLPITNDDNLRKSFESARPLLRLLIQRRGESWEEKYGYGTDSDKRWKGISSLMAQKPP 126

Query: 95  -----------FLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGL 143
                      F +VS IIDVD+VPE  RRVRL K    ERPLGFYIRDGTS+RVT  G+
Sbjct: 127 KRSYSISNPEDFRQVSAIIDVDIVPEAHRRVRLCKH-GQERPLGFYIRDGTSVRVTERGV 185

Query: 144 DKFLRI 149
            K   I
Sbjct: 186 VKVSGI 191
Necessary for apicobasal and anterior-posterior asymmetries associated with cell adhesion and gastrulation during the first few cell cycles of embryogenesis. Required for localizing/ maintaining par-3 at the cell periphery. Acts together with par-3 and pkc-3 in maintaining epithelial cell polarity in the distal spermatheca.
Caenorhabditis elegans (taxid: 6239)
>sp|Q9NPB6|PAR6A_HUMAN Partitioning defective 6 homolog alpha OS=Homo sapiens GN=PARD6A PE=1 SV=1 Back     alignment and function description
>sp|Q9JK84|PAR6G_MOUSE Partitioning defective 6 homolog gamma OS=Mus musculus GN=Pard6g PE=2 SV=1 Back     alignment and function description
>sp|Q9BYG5|PAR6B_HUMAN Partitioning defective 6 homolog beta OS=Homo sapiens GN=PARD6B PE=1 SV=1 Back     alignment and function description
>sp|Q9JK83|PAR6B_MOUSE Partitioning defective 6 homolog beta OS=Mus musculus GN=Pard6b PE=1 SV=2 Back     alignment and function description
>sp|Q9BYG4|PAR6G_HUMAN Partitioning defective 6 homolog gamma OS=Homo sapiens GN=PARD6G PE=1 SV=1 Back     alignment and function description
>sp|Q9Z101|PAR6A_MOUSE Partitioning defective 6 homolog alpha OS=Mus musculus GN=Pard6a PE=1 SV=2 Back     alignment and function description
>sp|Q6B4M5|PAR6A_RAT Partitioning defective 6 homolog alpha OS=Rattus norvegicus GN=Pard6a PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
193666982 309 PREDICTED: partitioning defective protei 0.708 0.368 0.467 2e-31
91087027 309 PREDICTED: similar to par-6 gamma [Tribo 0.708 0.368 0.439 3e-26
270010517 390 hypothetical protein TcasGA2_TC009924 [T 0.708 0.292 0.439 4e-26
158293124 314 AGAP010494-PA [Anopheles gambiae str. PE 0.708 0.363 0.419 4e-25
427796867 323 Putative cell polarity protein par6, par 0.757 0.377 0.411 1e-24
312374864 315 hypothetical protein AND_15416 [Anophele 0.708 0.361 0.419 1e-24
346467061 323 hypothetical protein [Amblyomma maculatu 0.708 0.352 0.430 2e-24
327343820 383 partitioning defective 6 [Lymnaea stagna 0.726 0.305 0.403 4e-24
391330114 310 PREDICTED: partitioning defective 6 homo 0.689 0.358 0.416 4e-24
321478636 322 hypothetical protein DAPPUDRAFT_230177 [ 0.701 0.350 0.430 6e-24
>gi|193666982|ref|XP_001949198.1| PREDICTED: partitioning defective protein 6-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 96/167 (57%), Gaps = 53/167 (31%)

Query: 32  FDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYI-ATDGDLLPINNDSNLGKA 90
           FDAEFRR S+PK D+ TY +F+IL+E+LH L E+PF L+Y    DGDLLPINND NLG+A
Sbjct: 17  FDAEFRRISLPKTDVGTYEQFRILIERLHKLIEVPFVLSYTDPKDGDLLPINNDDNLGRA 76

Query: 91  LLNS---------------------------------------------------FLRVS 99
           +L +                                                   F +VS
Sbjct: 77  VLTAKPLLRIIVQRKGESLEELNGYGSYRPRNIISSILGGTPSKAKHLWISNPQDFRQVS 136

Query: 100 QIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDKF 146
            IIDVDVVP+TCRRVRLLK   SERPLGFYIRDGTS+RV+ +G++K 
Sbjct: 137 AIIDVDVVPDTCRRVRLLKH-GSERPLGFYIRDGTSVRVSPSGVEKV 182

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91087027|ref|XP_974307.1| PREDICTED: similar to par-6 gamma [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270010517|gb|EFA06965.1| hypothetical protein TcasGA2_TC009924 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158293124|ref|XP_314468.4| AGAP010494-PA [Anopheles gambiae str. PEST] gi|157016808|gb|EAA09930.4| AGAP010494-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|427796867|gb|JAA63885.1| Putative cell polarity protein par6, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|312374864|gb|EFR22338.1| hypothetical protein AND_15416 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|346467061|gb|AEO33375.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|327343820|dbj|BAK09600.1| partitioning defective 6 [Lymnaea stagnalis] Back     alignment and taxonomy information
>gi|391330114|ref|XP_003739509.1| PREDICTED: partitioning defective 6 homolog gamma-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|321478636|gb|EFX89593.1| hypothetical protein DAPPUDRAFT_230177 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
WB|WBGene00003921 309 par-6 [Caenorhabditis elegans 0.428 0.223 0.506 2.6e-28
UNIPROTKB|Q9NAN2 309 par-6 "Partitioning defective 0.428 0.223 0.506 2.6e-28
FB|FBgn0026192 351 par-6 "par-6" [Drosophila mela 0.322 0.148 0.698 3.9e-27
ZFIN|ZDB-GENE-090312-133 381 pard6b "par-6 partitioning def 0.341 0.144 0.625 1.3e-22
UNIPROTKB|Q0PVE4 370 PARD6B "PAR6B" [Gallus gallus 0.310 0.135 0.647 4.3e-22
UNIPROTKB|Q9IAS9 377 pard6b "PAR-6" [Xenopus laevis 0.310 0.132 0.647 9.9e-22
UNIPROTKB|F1P0U8 304 F1P0U8 "Uncharacterized protei 0.416 0.220 0.449 6.4e-21
RGD|1305016 382 Pard6g "par-6 partitioning def 0.614 0.259 0.420 2.5e-12
MGI|MGI:2135606 382 Pard6g "par-6 partitioning def 0.614 0.259 0.392 8.9e-12
MGI|MGI:2135605 371 Pard6b "par-6 (partitioning de 0.614 0.266 0.407 1.1e-11
WB|WBGene00003921 par-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 2.6e-28, Sum P(2) = 2.6e-28
 Identities = 38/75 (50%), Positives = 50/75 (66%)

Query:    22 YHKYNAFTLS----FDAEFRRFSVPKPDIS--TYNEFKILVEKLHHLDEIPFHLTYIATD 75
             YH+ +  TL     FD+E+RRFS+P    S  +Y+ F+ LVEKLHHL+ + F L Y +T 
Sbjct:     7 YHQNHHSTLQVKSKFDSEWRRFSIPMHSASGVSYDGFRSLVEKLHHLESVQFTLCYNSTG 66

Query:    76 GDLLPINNDSNLGKA 90
             GDLLPI ND NL K+
Sbjct:    67 GDLLPITNDDNLRKS 81
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0040007 "growth" evidence=IMP
GO:0002119 "nematode larval development" evidence=IMP
GO:0040010 "positive regulation of growth rate" evidence=IMP
GO:0006898 "receptor-mediated endocytosis" evidence=IMP
GO:0000003 "reproduction" evidence=IMP
GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP
GO:0005938 "cell cortex" evidence=IDA
GO:0005080 "protein kinase C binding" evidence=IPI
UNIPROTKB|Q9NAN2 par-6 "Partitioning defective protein 6" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0026192 par-6 "par-6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090312-133 pard6b "par-6 partitioning defective 6 homolog beta (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q0PVE4 PARD6B "PAR6B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9IAS9 pard6b "PAR-6" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0U8 F1P0U8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305016 Pard6g "par-6 partitioning defective 6 homolog gamma (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2135606 Pard6g "par-6 partitioning defective 6 homolog gamma (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2135605 Pard6b "par-6 (partitioning defective 6) homolog beta (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
cd0640380 cd06403, PB1_Par6, The PB1 domain is an essential 2e-22
smart0066681 smart00666, PB1, PB1 domain 1e-10
cd0599281 cd05992, PB1, The PB1 domain is a modular domain m 4e-09
pfam0056484 pfam00564, PB1, PB1 domain 2e-08
>gnl|CDD|99724 cd06403, PB1_Par6, The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information 
 Score = 84.7 bits (210), Expect = 2e-22
 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 32 FDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKAL 91
          FDAEFRRFS+ +     + +F  L+E LHH+  + F + Y    GDLLPINND N  KAL
Sbjct: 7  FDAEFRRFSLDRNKPGKFEDFYKLLEHLHHIPNVDFLIGYTDPHGDLLPINNDDNFLKAL 66

Query: 92 L--NSFLRV 98
             N  LR+
Sbjct: 67 SSANPLLRI 75

The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The Par6 protein contains a type II PB1 domain. Length = 80
>gnl|CDD|214770 smart00666, PB1, PB1 domain Back     alignment and domain information
>gnl|CDD|99716 cd05992, PB1, The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>gnl|CDD|215996 pfam00564, PB1, PB1 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
KOG3606|consensus 358 100.0
cd0640380 PB1_Par6 The PB1 domain is an essential part of Pa 100.0
cd0640287 PB1_p62 The PB1 domain is an essential part of p62 99.5
cd0639891 PB1_Joka2 The PB1 domain is present in the Nicotia 99.31
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 99.23
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 99.2
cd0599281 PB1 The PB1 domain is a modular domain mediating s 99.11
cd0639782 PB1_UP1 Uncharacterized protein 1. The PB1 domain 98.71
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 98.62
cd0640181 PB1_TFG The PB1 domain found in TFG protein, an on 98.55
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 98.45
cd0640483 PB1_aPKC PB1 domain is an essential modular domain 97.92
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 97.82
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 95.62
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 95.29
cd0641097 PB1_UP2 Uncharacterized protein 2. The PB1 domain 89.97
cd0639992 PB1_P40 The PB1 domain is essential part of the p4 86.44
cd0641178 PB1_p51 The PB1 domain is present in the p51 prote 82.57
>KOG3606|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.6e-79  Score=530.23  Aligned_cols=137  Identities=55%  Similarity=0.818  Sum_probs=134.8

Q ss_pred             cceeEEeecccceeeeeccCCCCCcchHHHHHHHHhhccCCCCCeEEEEecCCCCceeccCccchHHHHhhc--------
Q psy16076         23 HKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNS--------   94 (161)
Q Consensus        23 ~~~veVKSKFdAEFRRFsl~r~~~~~feeF~~Ll~~lH~L~~vdf~I~YtD~~GDLLPINNDDNf~kAl~sa--------   94 (161)
                      +++|||||||||||||||++|+++++|+|||+||+++|+|+|+||+|+|+|+|||||||||||||+||++||        
T Consensus        16 ~~~veVKSKFdaEfRRfsl~r~~~~~f~~F~~Lv~~~H~i~nvdvllgY~d~hgDLLPinNDDn~~ka~~sa~PlLR~~i   95 (358)
T KOG3606|consen   16 SSTVEVKSKFDAEFRRFSLPRHSASSFDEFYSLVEHLHHIPNVDVLLGYADTHGDLLPINNDDNLHKALSSARPLLRLLI   95 (358)
T ss_pred             cceEEeeccccchhheecccccCcccHHHHHHHHHHHhcCCCceEEEEEecCCCceecccCchhHHHHhhccCchhhhhh
Confidence            459999999999999999999999999999999999999999999999999999999999999999999997        


Q ss_pred             -----------------------------------------------ccccceEEEeeccccccceeeeccCCCCCCcee
Q psy16076         95 -----------------------------------------------FLRVSQIIDVDVVPETCRRVRLLKSPNSERPLG  127 (161)
Q Consensus        95 -----------------------------------------------FR~VSaIiDVDilPeT~RRVrL~k~pgsdkpLG  127 (161)
                                                                     ||||||||||||+|||||||||||| |||||||
T Consensus        96 Qkr~ea~~~~~~fgt~sl~rr~~gl~~~lr~~~p~rr~~~~Is~P~DFRqVSsIIDVDivPEtHRRVRL~kh-G~ekPLG  174 (358)
T KOG3606|consen   96 QKREEADEEKYGFGTDSLQRRKKGLSSLLRPKPPKRRPHLSISLPQDFRQVSSIIDVDIVPETHRRVRLHKH-GSEKPLG  174 (358)
T ss_pred             hhhhhhhhhccCcccccHHHHhHhhHhhhcCCCCccCCCccccCccccceeceeeeecccchhhhheehhhc-CCCCCce
Confidence                                                           9999999999999999999999999 9999999


Q ss_pred             EEEeeCceeEecCCccccccceEEEeeeecCcC
Q psy16076        128 FYIRDGTSLRVTSTGLDKFLRISSSTKYINDLT  160 (161)
Q Consensus       128 FYIRdGtSvRvt~~GlEKvPGiFISrlV~~~~~  160 (161)
                      ||||||+||||||+||||||||||||||=|||.
T Consensus       175 FYIRDG~SVRVtp~GlekvpGIFISRlVpGGLA  207 (358)
T KOG3606|consen  175 FYIRDGTSVRVTPHGLEKVPGIFISRLVPGGLA  207 (358)
T ss_pred             EEEecCceEEeccccccccCceEEEeecCCccc
Confidence            999999999999999999999999999999985

>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover Back     alignment and domain information
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>cd06397 PB1_UP1 Uncharacterized protein 1 Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3 proteins is crucial for establishment of apical-basal polarity of animal cells Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>cd06410 PB1_UP2 Uncharacterized protein 2 Back     alignment and domain information
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis Back     alignment and domain information
>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1ry4_A128 Nmr Structure Of The Crib-Pdz Module Of Par-6 Lengt 9e-15
2lc6_A128 Solution Structure Of Par-6 Q144cL164C Length = 128 1e-13
1nf3_C128 Structure Of Cdc42 In A Complex With The Gtpase-Bin 5e-12
1wmh_B86 Crystal Structure Of A Pb1 Domain Complex Of Protei 2e-09
1rzx_A98 Crystal Structure Of A Par-6 Pdz-Peptide Complex Le 8e-09
1x8s_A102 Structure Of The Par-6 Pdz Domain With A Pals1 Inte 9e-09
>pdb|1RY4|A Chain A, Nmr Structure Of The Crib-Pdz Module Of Par-6 Length = 128 Back     alignment and structure 
Iteration: 1

 Score = 75.9 bits (185), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 37/51 (72%), Positives = 45/51 (88%), Gaps = 1/51 (1%)
Query: 95  FLRVSQIIDVDVVPETCRRVRLLKSPNSERPLGFYIRDGTSLRVTSTGLDK 145
           F +VS IIDVD+VPET RRVRLLK   S++PLGFYIRDGTS+RVT++GL+K
Sbjct: 15  FRQVSAIIDVDIVPETHRRVRLLKH-GSDKPLGFYIRDGTSVRVTASGLEK 64
>pdb|2LC6|A Chain A, Solution Structure Of Par-6 Q144cL164C Length = 128 Back     alignment and structure
>pdb|1NF3|C Chain C, Structure Of Cdc42 In A Complex With The Gtpase-Binding Domain Of The Cell Polarity Protein, Par6 Length = 128 Back     alignment and structure
>pdb|1WMH|B Chain B, Crystal Structure Of A Pb1 Domain Complex Of Protein Kinase C Iota And Par6 Alpha Length = 86 Back     alignment and structure
>pdb|1RZX|A Chain A, Crystal Structure Of A Par-6 Pdz-Peptide Complex Length = 98 Back     alignment and structure
>pdb|1X8S|A Chain A, Structure Of The Par-6 Pdz Domain With A Pals1 Internal Ligand Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1wmh_B86 Partitioning defective-6 homolog alpha; kinase, PB 4e-25
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 5e-08
>1wmh_B Partitioning defective-6 homolog alpha; kinase, PB1 domain, OPCA motif, APKC, cell polarity, transferase/cell cycle complex; 1.50A {Homo sapiens} SCOP: d.15.2.2 Length = 86 Back     alignment and structure
 Score = 91.3 bits (227), Expect = 4e-25
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 32 FDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKAL 91
          FDAEFRRF++P+  +S + EF  L+  +H +  +   L Y    GDLLP+ ND +L +AL
Sbjct: 13 FDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRAL 72

Query: 92 L--NSFLRV 98
                LR+
Sbjct: 73 ASGPPPLRL 81
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
1wmh_B86 Partitioning defective-6 homolog alpha; kinase, PB 100.0
2kkc_A102 Sequestosome-1; P62, PB1, autophagy, ubiquitin-pro 99.61
2ktr_A117 Sequestosome-1; autophagy, NF-KB signaling, HOMO-o 99.55
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.64
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 98.47
2bkf_A87 Zinc-finger protein NBR1 (NEXT to breast cancer 1; 98.18
1wj6_A101 KIAA0049 protein, RSGI RUH-024; PB1 domain, protei 98.05
1pqs_A77 Cell division control protein 24; alpha and beta p 95.97
1q1o_A98 Cell division control protein 24; PB1 domain, PCCR 95.73
1oey_J107 P40-PHOX, neutrophil cytosol factor 4; immune syst 94.24
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 93.43
2cu1_A103 Mitogen-activated protein kinase kinase kinase 2; 93.37
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 93.31
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 89.92
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 88.94
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 88.49
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 88.47
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 87.45
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 86.9
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 86.65
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 86.26
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 85.6
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 83.97
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 82.66
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 82.45
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 81.89
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 81.61
2awx_A105 Synapse associated protein 97; membrane protein, s 80.13
>1wmh_B Partitioning defective-6 homolog alpha; kinase, PB1 domain, OPCA motif, APKC, cell polarity, transferase/cell cycle complex; 1.50A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
Probab=100.00  E-value=1.3e-35  Score=216.81  Aligned_cols=72  Identities=36%  Similarity=0.679  Sum_probs=69.9

Q ss_pred             cceeEEeecccceeeeeccCCCCCcchHHHHHHHHhhccCCCCCeEEEEecCCCCceeccCccchHHHHhhc
Q psy16076         23 HKYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNS   94 (161)
Q Consensus        23 ~~~veVKSKFdAEFRRFsl~r~~~~~feeF~~Ll~~lH~L~~vdf~I~YtD~~GDLLPINNDDNf~kAl~sa   94 (161)
                      .+++|||||||||||||||+++++++||+||++|+++|+|.+++|+|+|+|+|||||||||||||++|+++|
T Consensus         4 ~~~l~vKskf~aE~RRFs~d~~~~~~fe~f~~lv~~lh~L~~~~f~i~Y~D~dGDLlpInnDdnl~~Al~~a   75 (86)
T 1wmh_B            4 MSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASG   75 (86)
T ss_dssp             -CEEEEEEEETTEEEEEEEEGGGCCCHHHHHHHHHHHTTCTTCCCEEEEECTTSCEEECCSHHHHHHHTTSS
T ss_pred             CCEEEEEeecCCeeeEeEccCCCCCCHHHHHHHHHHHcCCCCCCEEEEEECCCCCEeeecCHHHHHHHHHhC
Confidence            367999999999999999999999999999999999999999999999999999999999999999999998
>2kkc_A Sequestosome-1; P62, PB1, autophagy, ubiquitin-proteasome system, NF-KB signaling, alternative splicing, apoptosis, cytoplasm, differentiation; NMR {Rattus norvegicus} PDB: 2ktr_B Back     alignment and structure
>2ktr_A Sequestosome-1; autophagy, NF-KB signaling, HOMO-oligomer, PB1 dimer, signaling protein, transport protein; NMR {Rattus norvegicus} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>2bkf_A Zinc-finger protein NBR1 (NEXT to breast cancer 1; PB1 domain, interaction domain, Z finger; 1.56A {Homo sapiens} SCOP: d.15.2.2 PDB: 2g4s_A Back     alignment and structure
>1wj6_A KIAA0049 protein, RSGI RUH-024; PB1 domain, protein binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1pqs_A Cell division control protein 24; alpha and beta protein, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1tz1_A Back     alignment and structure
>1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B Back     alignment and structure
>1oey_J P40-PHOX, neutrophil cytosol factor 4; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2cu1_A Mitogen-activated protein kinase kinase kinase 2; PB1 domain, MAPK/ERK kinase kinase 2, MEK kinase 2, MEKK 2, signaling protein; NMR {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1wmhb_82 d.15.2.2 (B:) Partitioning defective-6 homolog alp 3e-25
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 9e-07
d2bkfa185 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NB 4e-04
>d1wmhb_ d.15.2.2 (B:) Partitioning defective-6 homolog alpha, PAR-6 alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: CAD & PB1 domains
family: PB1 domain
domain: Partitioning defective-6 homolog alpha, PAR-6 alpha
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 90.5 bits (225), Expect = 3e-25
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 32 FDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKAL 91
          FDAEFRRF++P+  +S + EF  L+  +H +  +   L Y    GDLLP+ ND +L +AL
Sbjct: 9  FDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRAL 68

Query: 92 L--NSFLRV 98
                LR+
Sbjct: 69 ASGPPPLRL 77
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1wmhb_82 Partitioning defective-6 homolog alpha, PAR-6 alph 100.0
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.12
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 98.23
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 98.15
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 96.81
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 95.21
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 94.79
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 94.11
d1wmha_83 Protein kinase C, iota type {Human (Homo sapiens) 93.62
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 92.12
d1oeyj_105 Neutrophil cytosol factor 4 (p40phox component of 91.2
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 90.81
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 90.8
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 90.69
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 90.48
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 90.34
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 89.7
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 87.34
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 86.71
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 86.53
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 86.06
d1x45a185 Amyloid beta A4 precursor protein-binding family A 85.48
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 85.08
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 84.98
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 84.72
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 83.72
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 83.17
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 82.98
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 82.78
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 82.34
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 81.24
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 80.78
>d1wmhb_ d.15.2.2 (B:) Partitioning defective-6 homolog alpha, PAR-6 alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: CAD & PB1 domains
family: PB1 domain
domain: Partitioning defective-6 homolog alpha, PAR-6 alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.6e-43  Score=253.70  Aligned_cols=71  Identities=37%  Similarity=0.694  Sum_probs=69.9

Q ss_pred             ceeEEeecccceeeeeccCCCCCcchHHHHHHHHhhccCCCCCeEEEEecCCCCceeccCccchHHHHhhc
Q psy16076         24 KYNAFTLSFDAEFRRFSVPKPDISTYNEFKILVEKLHHLDEIPFHLTYIATDGDLLPINNDSNLGKALLNS   94 (161)
Q Consensus        24 ~~veVKSKFdAEFRRFsl~r~~~~~feeF~~Ll~~lH~L~~vdf~I~YtD~~GDLLPINNDDNf~kAl~sa   94 (161)
                      ++|||||||||||||||++|+++++|||||+|||++|+|+++||+|||||+|||||||||||||+||++||
T Consensus         1 s~veVKSKFdAEfRRFsl~r~~~~~fe~F~~Lle~~H~l~~~~f~i~Y~D~hgDLLPINNDdNf~kA~~sa   71 (82)
T d1wmhb_           1 SIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASG   71 (82)
T ss_dssp             CEEEEEEEETTEEEEEEEEGGGCCCHHHHHHHHHHHTTCTTCCCEEEEECTTSCEEECCSHHHHHHHTTSS
T ss_pred             CceEeecccCceEEEeeeccccccCHHHHHHHHHHHcCCCCCcEEEEEecCCCCcccccCchHHHHHHHhc
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmha_ d.15.2.2 (A:) Protein kinase C, iota type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oeyj_ d.15.2.2 (J:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure