Diaphorina citri psyllid: psy16108


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MGDQLNEAQQNEMMKTQINTFKEFLLQYNKITEICFKDCVNHFISREITKKEESCAVNCLEKYMKMTSRISMRMQEFQMLQNEQMLAASGGNKP
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
****************QINTFKEFLLQYNKITEICFKDCVNHFISREITKKEESCAVNCLEKYMKMTSRISMRM********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDQLNEAQQNEMMKTQINTFKEFLLQYNKITEICFKDCVNHFISREITKKEESCAVNCLEKYMKMTSRISMRMQEFQMLQNEQMLAASGGNKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import inner membrane translocase subunit tim9 Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.confidentQ4WIQ2
Mitochondrial import inner membrane translocase subunit Tim9 Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.confidentQ9W762
Mitochondrial import inner membrane translocase subunit Tim9 Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.confidentQ9WV97

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0072321 [BP]chaperone-mediated protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0044765, GO:0008150, GO:0071702, GO:0015031, GO:0051234, GO:0051179, GO:0044699
GO:0042719 [CC]mitochondrial intermembrane space protein transporter complexprobableGO:0031970, GO:0031974, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005740, GO:0005739, GO:0005758, GO:0031967, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005215 [MF]transporter activityprobableGO:0003674
GO:0045039 [BP]protein import into mitochondrial inner membraneprobableGO:0008104, GO:0072655, GO:0061024, GO:0071840, GO:0007007, GO:0007006, GO:0044699, GO:0071806, GO:0070727, GO:0016044, GO:0006886, GO:0016043, GO:0051179, GO:0065002, GO:0007005, GO:0071702, GO:0051641, GO:0034613, GO:0006810, GO:0072594, GO:0006626, GO:0017038, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0008150, GO:0051649, GO:0006839, GO:0051234, GO:0055085, GO:0044743, GO:0016482, GO:0006996, GO:0070585, GO:0033036, GO:0046907, GO:0015031, GO:0044763, GO:0009987
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0042721 [CC]mitochondrial inner membrane protein insertion complexprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0051087 [MF]chaperone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0040007 [BP]growthprobableGO:0008150
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BSK, chain A
Confidence level:very confident
Coverage over the Query: 20-90
View the alignment between query and template
View the model in PyMOL