Diaphorina citri psyllid: psy16109


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MTLQALRVLLKKEPPRNKKLLVLCTTSCREVLEDLKILSKFSAVLHVPNLSTPEHLLNVIEESDVFSKKQVQEIERYLHQHKARVFVGIRKLLGLIDMARQIEENYRVMKFLTKLEDEGCLDMGTSILH
cHHHHHHHHHccccccccEEEEEEccccHHHHHHcccHHHHcccEEccccccHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccc
MTLQALRVLLKKEPPRNKKLLVLCTTSCREVLEDLKILSKFSAVLHVPNLSTPEHLLNVIEESDVFSKKQVQEIERYLHQHKARVFVGIRKLLGLIDMARQIEENYRVMKFLTKLEDEGCLDMGTSIL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLQALRVLLKKEPPRNKKLLVLCTTSCREVLEDLKILSKFSAVLHVPNLSTPEHLLNVIEESDVFSKKQVQEIERYLHQHKARVFVGIRKLLGLIDMARQIEENYRVMKFLTKLEDEGCLDMGTSILH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle-fusing ATPase 1 Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.confidentP46461

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0048172 [BP]regulation of short-term neuronal synaptic plasticityprobableGO:0010646, GO:0044057, GO:0031644, GO:0050804, GO:0050789, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0065008, GO:0048168, GO:0050794
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031201 [CC]SNARE complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D2N, chain A
Confidence level:very confident
Coverage over the Query: 17-121
View the alignment between query and template
View the model in PyMOL