Diaphorina citri psyllid: psy16111

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MMLDIPEDNEEGEQDTPDKPKELKQLWTGCFQQSMNEFLQQFNESISVDEVLYREDIAGSIAHVTMLGERNIIDEQDKELIVKTLKDIEYDIEHGKVELKVELEDIHMNIESELIRRIGNVGRKLHTGKTLKALLLP
ccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccccc
******************************FQQSMNEFLQQFNESISVDEVLYREDIAGSIAHVTMLGERNIIDEQDKELIVKTLKDIEYDIEHGKVELKVELEDIHMNIESELIRRIGNVGRKLHTGKTLKALLL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLDIPEDNEEGEQDTPDKPKELKQLWTGCFQQSMNEFLQQFNESISVDEVLYREDIAGSIAHVTMLGERNIIDEQDKELIVKTLKDIEYDIEHGKVELKVELEDIHMNIESELIRRIGNVGRKLHTGKTLKALLLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Argininosuccinate lyase confidentC4Z0V2
Argininosuccinate lyase confidentB2V6Y7
Argininosuccinate lyase confidentC6E6Y9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004056 [MF]argininosuccinate lyase activityprobableGO:0003824, GO:0016829, GO:0003674, GO:0016840, GO:0016842

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K7W, chain A
Confidence level:very confident
Coverage over the Query: 35-137
View the alignment between query and template
View the model in PyMOL