Diaphorina citri psyllid: psy16115


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MHEINTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV
ccccccEEEEECccccccccccccccccHHHHHHHHHHHcccccEEECcEEECcHccHHHcccccccEEccccccccHHHHccccccccccccccHHHHHHHHcCECcccEEEEEccccccHHHHHHHcccccEEEEEEccHHHHHHHHHcccEEEEHHHHHccccEEEEcccccccccHHHHcccccccEEEccccccccccccccccccccEEEccccccEEEccccccccccEEEEEEccccccEEEEEcccccc
***INTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHEINTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative adenosylhomocysteinase 2 confidentQ80SW1
Putative adenosylhomocysteinase 2 confidentO43865
Adenosylhomocysteinase May play a key role in the regulation of the intracellular concentration of adenosylhomocysteine.confidentQ7NZF7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006378 [BP]mRNA polyadenylationprobableGO:0090304, GO:0034641, GO:0006807, GO:0043631, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0044238, GO:0031124, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0031440 [BP]regulation of mRNA 3'-end processingprobableGO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0051252, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0010468
GO:0006611 [BP]protein export from nucleusprobableGO:0051169, GO:0051168, GO:0016482, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0006810, GO:0006913, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0032412 [BP]regulation of ion transmembrane transporter activityprobableGO:0022898, GO:0050794, GO:0008150, GO:0032409, GO:0065007, GO:0034762, GO:0051049, GO:0034765, GO:0065009, GO:0032879, GO:0050789, GO:0043269
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006730 [BP]one-carbon metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0008150, GO:0044281, GO:0008152
GO:0010765 [BP]positive regulation of sodium ion transportprobableGO:0010959, GO:0051050, GO:0051049, GO:0043270, GO:0065007, GO:0002028, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0004013 [MF]adenosylhomocysteinase activityprobableGO:0016801, GO:0016787, GO:0016802, GO:0003674, GO:0003824
GO:0044070 [BP]regulation of anion transportprobableGO:0051049, GO:0008150, GO:0065007, GO:0032879, GO:0050789, GO:0043269
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GVP, chain A
Confidence level:very confident
Coverage over the Query: 93-245
View the alignment between query and template
View the model in PyMOL
Template: 1V8B, chain A
Confidence level:very confident
Coverage over the Query: 47-228
View the alignment between query and template
View the model in PyMOL
Template: 3H9U, chain A
Confidence level:very confident
Coverage over the Query: 7-96
View the alignment between query and template
View the model in PyMOL