Psyllid ID: psy16115


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MHEINTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV
ccccccEEEEEEccccccccccccccccHHHHHHHHHHHcccccEEEEcEEEEHHccHHHcccccccEEccccccccHHHHcccccccccccccHHHHHHHHHcEEEcccEEEEEccccccHHHHHHHcccccEEEEEEccHHHHHHHHHcccEEEEHHHHHccccEEEEcccccccccHHHHHccccccEEEccccccccccccccccccccEEEccccccEEEccccccccccEEEEEEccccccEEEEEcccccc
cccHHHHHHHccccHccccccEcccccHHHHHHHHHHHHHccccHcccEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEccHHHHcccccEEEEcccccccEcHHHHccccccEEEEEcccccccEcHHHHHHHccEEEEEEccEEEEEccccccccccEEEEEEccccHHHHHHHcccccc
MHEINTVqwtlgfkrrvspvcirsnpliIPQALALIELFnapagryksdvyllpkKMDEYVASLHLPTFDAHLTELSDEQAKYMglnkagpfkpsyyslkrstdvmfggKQVVLCGygevgkgccqslkglgcvIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMdkmkngcvvcnmghsnteidvnslrtpdltwEKVRSQVDhviwpdvnlknntvidlfrkpksRLYLEILQTCPLV
mheintvqwtlgfkrrvsPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTatgnknvvtrehmdkMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVdhviwpdvnlknntvidlfrkpksrlyleilqtcplv
MHEINTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV
***INTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTC***
***INTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV
MHEINTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV
*HEINTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHEINTVQWTLGFKRRVSPVCIRSNPLIIPQALALIELFNAPAGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDVNLKNNTVIDLFRKPKSRLYLEILQTCPLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query258 2.2.26 [Sep-21-2011]
Q80SW1530 Putative adenosylhomocyst yes N/A 0.503 0.245 0.846 9e-65
O43865530 Putative adenosylhomocyst yes N/A 0.503 0.245 0.846 9e-65
Q96HN2611 Putative adenosylhomocyst no N/A 0.503 0.212 0.823 7e-64
Q68FL4613 Putative adenosylhomocyst no N/A 0.503 0.212 0.823 8e-64
Q5R889508 Putative adenosylhomocyst no N/A 0.507 0.257 0.809 5e-63
P50245492 Putative adenosylhomocyst no N/A 0.503 0.264 0.786 2e-62
Q7NZF7466 Adenosylhomocysteinase OS yes N/A 0.5 0.276 0.572 4e-42
A9KD88438 Adenosylhomocysteinase OS yes N/A 0.5 0.294 0.580 1e-41
B6J6H1438 Adenosylhomocysteinase OS yes N/A 0.5 0.294 0.580 1e-41
Q83A77438 Adenosylhomocysteinase OS yes N/A 0.5 0.294 0.580 2e-41
>sp|Q80SW1|SAHH2_MOUSE Putative adenosylhomocysteinase 2 OS=Mus musculus GN=Ahcyl1 PE=1 SV=1 Back     alignment and function desciption
 Score =  246 bits (629), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 110/130 (84%), Positives = 122/130 (93%)

Query: 99  LKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKL 158
           LKR+TDVMFGGKQVV+CGYGEVGKGCC +LK LG ++YITEIDPICALQACMDGF VVKL
Sbjct: 301 LKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKL 360

Query: 159 NEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVR 218
           NEVIR VD+V+T TGNKNVVTREH+D+MKN C+VCNMGHSNTEIDV SLRTP+LTWE+VR
Sbjct: 361 NEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVR 420

Query: 219 SQVDHVIWPD 228
           SQVDHVIWPD
Sbjct: 421 SQVDHVIWPD 430





Mus musculus (taxid: 10090)
EC: 3EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|O43865|SAHH2_HUMAN Putative adenosylhomocysteinase 2 OS=Homo sapiens GN=AHCYL1 PE=1 SV=2 Back     alignment and function description
>sp|Q96HN2|SAHH3_HUMAN Putative adenosylhomocysteinase 3 OS=Homo sapiens GN=AHCYL2 PE=1 SV=1 Back     alignment and function description
>sp|Q68FL4|SAHH3_MOUSE Putative adenosylhomocysteinase 3 OS=Mus musculus GN=Ahcyl2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R889|SAHH3_PONAB Putative adenosylhomocysteinase 3 OS=Pongo abelii GN=AHCYL2 PE=2 SV=1 Back     alignment and function description
>sp|P50245|SAHH2_DROME Putative adenosylhomocysteinase 2 OS=Drosophila melanogaster GN=Ahcy89E PE=2 SV=2 Back     alignment and function description
>sp|Q7NZF7|SAHH_CHRVO Adenosylhomocysteinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|A9KD88|SAHH_COXBN Adenosylhomocysteinase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ahcY PE=3 SV=2 Back     alignment and function description
>sp|B6J6H1|SAHH_COXB1 Adenosylhomocysteinase OS=Coxiella burnetii (strain CbuK_Q154) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q83A77|SAHH_COXBU Adenosylhomocysteinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ahcY PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
242013664 549 adenosylhomocysteinase, putative [Pedicu 0.507 0.238 0.931 7e-70
307182708 564 Putative adenosylhomocysteinase 3 [Campo 0.507 0.232 0.923 4e-69
322789035 526 hypothetical protein SINV_08970 [Solenop 0.507 0.249 0.923 5e-69
110749750 532 PREDICTED: putative adenosylhomocysteina 0.507 0.246 0.916 6e-69
340709195 532 PREDICTED: putative adenosylhomocysteina 0.507 0.246 0.916 6e-69
332023183 539 Putative adenosylhomocysteinase 3 [Acrom 0.507 0.243 0.923 6e-69
307194517 540 Putative adenosylhomocysteinase 3 [Harpe 0.507 0.242 0.923 7e-69
383864821 528 PREDICTED: putative adenosylhomocysteina 0.507 0.248 0.916 8e-69
345486611 532 PREDICTED: putative adenosylhomocysteina 0.507 0.246 0.923 8e-69
340709197 516 PREDICTED: putative adenosylhomocysteina 0.507 0.253 0.916 8e-69
>gi|242013664|ref|XP_002427522.1| adenosylhomocysteinase, putative [Pediculus humanus corporis] gi|212511924|gb|EEB14784.1| adenosylhomocysteinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  269 bits (688), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (97%)

Query: 98  SLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVK 157
           SLKRSTDVMFGGKQV +CGYGEVGKGCCQ+LKGLGCV+Y+TEIDPICALQACMDGF VVK
Sbjct: 319 SLKRSTDVMFGGKQVAVCGYGEVGKGCCQALKGLGCVVYVTEIDPICALQACMDGFRVVK 378

Query: 158 LNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKV 217
           LNEVIR VDIVVTATGNKN+VTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKV
Sbjct: 379 LNEVIRNVDIVVTATGNKNIVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKV 438

Query: 218 RSQVDHVIWPD 228
           RSQVDH+IWPD
Sbjct: 439 RSQVDHIIWPD 449




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307182708|gb|EFN69832.1| Putative adenosylhomocysteinase 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322789035|gb|EFZ14493.1| hypothetical protein SINV_08970 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|110749750|ref|XP_624152.2| PREDICTED: putative adenosylhomocysteinase 3-like [Apis mellifera] gi|380027184|ref|XP_003697310.1| PREDICTED: putative adenosylhomocysteinase 3-like [Apis florea] Back     alignment and taxonomy information
>gi|340709195|ref|XP_003393197.1| PREDICTED: putative adenosylhomocysteinase 3-like isoform 1 [Bombus terrestris] gi|350425225|ref|XP_003494052.1| PREDICTED: putative adenosylhomocysteinase 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332023183|gb|EGI63439.1| Putative adenosylhomocysteinase 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307194517|gb|EFN76809.1| Putative adenosylhomocysteinase 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383864821|ref|XP_003707876.1| PREDICTED: putative adenosylhomocysteinase 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345486611|ref|XP_001605394.2| PREDICTED: putative adenosylhomocysteinase 3-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340709197|ref|XP_003393198.1| PREDICTED: putative adenosylhomocysteinase 3-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
FB|FBgn0035371521 CG9977 [Drosophila melanogaste 0.507 0.251 0.877 2.3e-62
ZFIN|ZDB-GENE-040115-5623 ahcyl2 "S-adenosylhomocysteine 0.503 0.208 0.815 2.6e-61
UNIPROTKB|F1P7I1524 AHCYL1 "Adenosylhomocysteinase 0.503 0.248 0.846 5.5e-61
UNIPROTKB|A6QNP1276 AHCYL1 "AHCYL1 protein" [Bos t 0.503 0.471 0.846 5.5e-61
UNIPROTKB|F1MWH2530 AHCYL1 "Adenosylhomocysteinase 0.503 0.245 0.846 5.5e-61
UNIPROTKB|E2REN0517 AHCYL1 "Adenosylhomocysteinase 0.503 0.251 0.846 5.5e-61
UNIPROTKB|O43865530 AHCYL1 "Putative adenosylhomoc 0.503 0.245 0.846 5.5e-61
UNIPROTKB|F1S610494 AHCYL1 "Adenosylhomocysteinase 0.503 0.263 0.846 5.5e-61
MGI|MGI:2385184530 Ahcyl1 "S-adenosylhomocysteine 0.503 0.245 0.846 5.5e-61
RGD|1309768529 Ahcyl1 "adenosylhomocysteinase 0.503 0.245 0.846 5.5e-61
FB|FBgn0035371 CG9977 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 637 (229.3 bits), Expect = 2.3e-62, P = 2.3e-62
 Identities = 115/131 (87%), Positives = 124/131 (94%)

Query:    98 SLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVK 157
             SLKRSTDVMFGGKQVV+CGYG+VGKGC Q+LKG GC++YITEIDPICALQA MDGF VVK
Sbjct:   291 SLKRSTDVMFGGKQVVVCGYGDVGKGCAQALKGQGCIVYITEIDPICALQASMDGFRVVK 350

Query:   158 LNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKV 217
             LNEVIR VDIVVTATGNKNVV REHMDKMK+GC+VCNMGHSNTEIDVN LRTPDLTWEKV
Sbjct:   351 LNEVIRNVDIVVTATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRTPDLTWEKV 410

Query:   218 RSQVDHVIWPD 228
             RSQVDH+IWP+
Sbjct:   411 RSQVDHIIWPE 421


GO:0004013 "adenosylhomocysteinase activity" evidence=ISS
GO:0006730 "one-carbon metabolic process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
ZFIN|ZDB-GENE-040115-5 ahcyl2 "S-adenosylhomocysteine hydrolase-like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7I1 AHCYL1 "Adenosylhomocysteinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A6QNP1 AHCYL1 "AHCYL1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWH2 AHCYL1 "Adenosylhomocysteinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2REN0 AHCYL1 "Adenosylhomocysteinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43865 AHCYL1 "Putative adenosylhomocysteinase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S610 AHCYL1 "Adenosylhomocysteinase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2385184 Ahcyl1 "S-adenosylhomocysteine hydrolase-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309768 Ahcyl1 "adenosylhomocysteinase-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7NZF7SAHH_CHRVO3, ., 3, ., 1, ., 10.57250.50.2768yesN/A
Q3B0K7SAHH_SYNS93, ., 3, ., 1, ., 10.54130.50770.2752yesN/A
B2T6X2SAHH_BURPP3, ., 3, ., 1, ., 10.52670.50.2727yesN/A
Q3A392SAHH_PELCD3, ., 3, ., 1, ., 10.54540.50770.2757yesN/A
Q80SW1SAHH2_MOUSE3, ., 3, ., 1, ., 10.84610.50380.2452yesN/A
Q13T36SAHH_BURXL3, ., 3, ., 1, ., 10.52670.50.2727yesN/A
A9KD88SAHH_COXBN3, ., 3, ., 1, ., 10.58010.50.2945yesN/A
Q3JY79SAHH_BURP13, ., 3, ., 1, ., 10.53430.50.2727yesN/A
Q63PT2SAHH_BURPS3, ., 3, ., 1, ., 10.53430.50.2727yesN/A
A9BD69SAHH_PROM43, ., 3, ., 1, ., 10.55300.50380.2731yesN/A
O43865SAHH2_HUMAN3, ., 3, ., 1, ., 10.84610.50380.2452yesN/A
A1V8Z2SAHH_BURMS3, ., 3, ., 1, ., 10.53430.50.2727yesN/A
Q82WL1SAHH_NITEU3, ., 3, ., 1, ., 10.55810.49220.2656yesN/A
Q7VUL8SAHH_BORPE3, ., 3, ., 1, ., 10.54960.50.2733yesN/A
A2S6W2SAHH_BURM93, ., 3, ., 1, ., 10.53430.50.2727yesN/A
Q0IDX7SAHH_SYNS33, ., 3, ., 1, ., 10.53380.50770.2752yesN/A
Q2YQX8SAHH_BRUA23, ., 3, ., 1, ., 10.53520.54260.3004yesN/A
A5GI30SAHH_SYNPW3, ., 3, ., 1, ., 10.54880.50770.2752yesN/A
Q318B6SAHH_PROM93, ., 3, ., 1, ., 10.53380.50770.2775yesN/A
B2S994SAHH_BRUA13, ., 3, ., 1, ., 10.53520.54260.3004yesN/A
A3MQW7SAHH_BURM73, ., 3, ., 1, ., 10.53430.50.2727yesN/A
P61617SAHH_GEOSL3, ., 3, ., 1, ., 10.51900.50.2715yesN/A
Q7UZN3SAHH_PROMP3, ., 3, ., 1, ., 10.54130.50770.2775yesN/A
A3PFB5SAHH_PROM03, ., 3, ., 1, ., 10.53380.50770.2775yesN/A
A8G7D1SAHH_PROM23, ., 3, ., 1, ., 10.53380.50770.2775yesN/A
Q83A77SAHH_COXBU3, ., 3, ., 1, ., 10.58010.50.2945yesN/A
Q60CG8SAHH_METCA3, ., 3, ., 1, ., 10.54960.50.2733yesN/A
Q3ANF4SAHH_SYNSC3, ., 3, ., 1, ., 10.54130.50770.2752yesN/A
Q57AG3SAHH_BRUAB3, ., 3, ., 1, ., 10.53520.54260.3004yesN/A
Q2STU0SAHH_BURTA3, ., 3, ., 1, ., 10.53430.50.2727yesN/A
A2C620SAHH_PROM33, ., 3, ., 1, ., 10.54540.50380.2731yesN/A
B6J6H1SAHH_COXB13, ., 3, ., 1, ., 10.58010.50.2945yesN/A
Q7U9Y3SAHH_SYNPX3, ., 3, ., 1, ., 10.53380.50770.2752yesN/A
B6J3R0SAHH_COXB23, ., 3, ., 1, ., 10.58010.50.2945yesN/A
A3NER1SAHH_BURP63, ., 3, ., 1, ., 10.53430.50.2727yesN/A
A9M9T1SAHH_BRUC23, ., 3, ., 1, ., 10.53520.54260.3004yesN/A
B2JIP4SAHH_BURP83, ., 3, ., 1, ., 10.54190.50.2727yesN/A
B0CJJ7SAHH_BRUSI3, ., 3, ., 1, ., 10.53520.54260.3004yesN/A
A1WXM7SAHH_HALHL3, ., 3, ., 1, ., 10.54960.50.3yesN/A
Q8YE49SAHH_BRUME3, ., 3, ., 1, ., 10.53520.54260.3004yesN/A
A3P0L8SAHH_BURP03, ., 3, ., 1, ., 10.53430.50.2727yesN/A
Q62G22SAHH_BURMA3, ., 3, ., 1, ., 10.53430.50.2727yesN/A
C0RFY3SAHH_BRUMB3, ., 3, ., 1, ., 10.53520.54260.3004yesN/A
Q8FXZ7SAHH_BRUSU3, ., 3, ., 1, ., 10.53520.54260.3004yesN/A
Q7V926SAHH_PROMM3, ., 3, ., 1, ., 10.54540.50380.2731yesN/A
Q0AEV8SAHH_NITEC3, ., 3, ., 1, ., 10.56920.49610.2677yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.3.10.691
3rd Layer3.3.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 1e-89
pfam00670162 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocystein 2e-80
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 2e-79
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 5e-79
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 6e-70
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 1e-62
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 1e-61
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 7e-55
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 5e-49
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 5e-49
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 4e-35
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 8e-30
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 7e-21
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 5e-20
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 1e-19
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 2e-17
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 9e-17
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 8e-14
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 2e-10
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 2e-06
smart01002149 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT 4e-06
cd12171310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 1e-05
pfam01262150 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, 1e-05
COG0111324 COG0111, SerA, Phosphoglycerate dehydrogenase and 6e-05
cd05198302 cd05198, formate_dh_like, Formate/glycerate and re 9e-05
cd05303301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 1e-04
cd12177321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 3e-04
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 3e-04
cd12165314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 4e-04
cd12157318 cd12157, PTDH, Thermostable Phosphite Dehydrogenas 4e-04
pfam02254116 pfam02254, TrkA_N, TrkA-N domain 5e-04
PRK00045423 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed 5e-04
PLN02928347 PLN02928, PLN02928, oxidoreductase family protein 5e-04
COG1052324 COG1052, LdhA, Lactate dehydrogenase and related d 0.001
cd12174305 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat 0.002
cd12175311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 0.002
cd05213311 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-bindi 0.004
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
 Score =  271 bits (695), Expect = 1e-89
 Identities = 85/151 (56%), Positives = 103/151 (68%), Gaps = 13/151 (8%)

Query: 98  SLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVK 157
            +KR+TDVM  GK  V+CGYG+VGKGC QSL+G G  + +TEIDPICALQA MDGF VV 
Sbjct: 196 GIKRATDVMIAGKVAVVCGYGDVGKGCAQSLRGQGARVIVTEIDPICALQAAMDGFEVVT 255

Query: 158 LNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRT-PDLTWEK 216
           + EV    DI VT TGNK+V+TREHM  MK+G +VCN+GH + EIDV SLR  P L WE 
Sbjct: 256 MEEVAPQADIFVTTTGNKDVITREHMRAMKDGAIVCNIGHFDNEIDVASLRNNPGLKWEN 315

Query: 217 VRSQVDHVIWPD------------VNLKNNT 235
           ++ QVDH+ +PD            VNL   T
Sbjct: 316 IKPQVDHITFPDGKRIILLAEGRLVNLGCAT 346


Length = 426

>gnl|CDD|109716 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|216396 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase Back     alignment and domain information
>gnl|CDD|216949 pfam02254, TrkA_N, TrkA-N domain Back     alignment and domain information
>gnl|CDD|234592 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 258
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 99.95
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.95
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 99.94
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 99.93
PRK06932314 glycerate dehydrogenase; Provisional 99.93
PRK06487317 glycerate dehydrogenase; Provisional 99.92
PRK13243333 glyoxylate reductase; Reviewed 99.92
PLN03139386 formate dehydrogenase; Provisional 99.91
PLN02306386 hydroxypyruvate reductase 99.91
PRK07574385 formate dehydrogenase; Provisional 99.91
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 99.91
KOG0068|consensus 406 99.9
PLN02928347 oxidoreductase family protein 99.9
KOG0069|consensus336 99.9
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.9
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.89
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 99.89
PTZ00075476 Adenosylhomocysteinase; Provisional 99.89
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 99.89
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.87
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.86
PRK06436303 glycerate dehydrogenase; Provisional 99.86
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 99.86
PRK12480330 D-lactate dehydrogenase; Provisional 99.86
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 99.86
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 99.85
PLN02494477 adenosylhomocysteinase 99.84
PRK08605332 D-lactate dehydrogenase; Validated 99.84
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 99.82
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 99.81
KOG1370|consensus434 99.79
KOG0024|consensus354 99.72
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.48
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.47
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.45
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.45
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.42
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.42
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.42
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.41
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.41
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.4
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 99.39
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.39
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 99.39
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.38
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 99.38
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.38
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.37
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.37
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.36
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.36
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.35
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.35
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.35
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.35
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.34
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.34
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.34
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.33
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.33
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.32
PRK13403 335 ketol-acid reductoisomerase; Provisional 99.32
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.32
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.32
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.32
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 99.31
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 99.31
KOG0067|consensus 435 99.3
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.29
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 99.27
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.27
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.24
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.24
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 99.17
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.14
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.13
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 99.13
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.1
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.06
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.05
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.03
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 99.02
PLN02827378 Alcohol dehydrogenase-like 99.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.0
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 99.0
PLN02740381 Alcohol dehydrogenase-like 98.98
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 98.98
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.96
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.96
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 98.96
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 98.95
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 98.95
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.95
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 98.94
PRK05479 330 ketol-acid reductoisomerase; Provisional 98.94
PLN02178375 cinnamyl-alcohol dehydrogenase 98.94
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.93
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 98.93
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 98.92
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.88
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 98.88
PLN02586360 probable cinnamyl alcohol dehydrogenase 98.86
KOG1370|consensus434 98.85
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 98.85
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 98.85
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 98.82
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 98.82
KOG0022|consensus375 98.81
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 98.81
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 98.81
PLN02712 667 arogenate dehydrogenase 98.77
KOG0023|consensus360 98.75
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 98.75
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 98.75
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 98.73
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.72
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 98.72
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 98.72
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.71
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 98.71
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 98.71
PTZ00075476 Adenosylhomocysteinase; Provisional 98.7
PLN02514357 cinnamyl-alcohol dehydrogenase 98.7
PLN02494477 adenosylhomocysteinase 98.69
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.68
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.67
PRK07417 279 arogenate dehydrogenase; Reviewed 98.66
PLN00203519 glutamyl-tRNA reductase 98.65
PRK05225 487 ketol-acid reductoisomerase; Validated 98.65
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 98.64
PLN02256 304 arogenate dehydrogenase 98.64
PRK10083339 putative oxidoreductase; Provisional 98.63
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 98.61
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 98.6
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.59
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 98.59
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 98.59
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.58
PRK15059 292 tartronate semialdehyde reductase; Provisional 98.58
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 98.58
PRK08507 275 prephenate dehydrogenase; Validated 98.55
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 98.55
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 98.55
PLN02858 1378 fructose-bisphosphate aldolase 98.54
PRK13940414 glutamyl-tRNA reductase; Provisional 98.53
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.53
PRK06545 359 prephenate dehydrogenase; Validated 98.53
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 98.52
PRK08655 437 prephenate dehydrogenase; Provisional 98.51
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.51
PLN02712 667 arogenate dehydrogenase 98.5
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.5
KOG4230|consensus 935 98.49
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.48
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 98.48
PLN02858 1378 fructose-bisphosphate aldolase 98.48
KOG0409|consensus 327 98.47
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 98.47
PLN02688 266 pyrroline-5-carboxylate reductase 98.45
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.45
PRK08818 370 prephenate dehydrogenase; Provisional 98.45
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 98.44
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.44
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 98.43
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 98.42
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.42
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 98.4
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 98.38
PRK14982340 acyl-ACP reductase; Provisional 98.38
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 98.38
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.36
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 98.35
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.34
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 98.31
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 98.3
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 98.3
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 98.3
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 98.3
PRK07340304 ornithine cyclodeaminase; Validated 98.29
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 98.29
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 98.29
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 98.28
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 98.27
KOG0089|consensus309 98.27
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 98.26
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 98.26
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.26
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 98.25
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 98.25
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.25
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 98.25
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 98.24
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 98.24
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 98.24
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 98.22
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 98.22
PRK08618325 ornithine cyclodeaminase; Validated 98.22
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 98.21
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 98.2
PRK06141314 ornithine cyclodeaminase; Validated 98.19
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.19
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 98.18
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 98.18
PLN02702364 L-idonate 5-dehydrogenase 98.18
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 98.18
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 98.17
PRK07680 273 late competence protein ComER; Validated 98.17
PRK06476 258 pyrroline-5-carboxylate reductase; Reviewed 98.16
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 98.15
PRK00676338 hemA glutamyl-tRNA reductase; Validated 98.14
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 98.14
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.13
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 98.13
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 98.1
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 98.1
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 98.09
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 98.08
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 98.07
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 98.06
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 98.06
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 98.03
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 98.03
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 98.03
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 98.02
KOG2380|consensus 480 98.0
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 98.0
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.99
PRK06823315 ornithine cyclodeaminase; Validated 97.98
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 97.97
PRK06046326 alanine dehydrogenase; Validated 97.96
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 97.96
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.95
PRK06407301 ornithine cyclodeaminase; Provisional 97.94
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.93
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 97.93
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 97.92
PF05221268 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; In 97.92
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 97.91
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 97.91
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 97.91
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.89
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.88
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 97.88
PRK11730 715 fadB multifunctional fatty acid oxidation complex 97.88
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 97.87
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.87
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 97.86
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.86
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 97.84
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 97.84
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 97.83
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 97.82
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 97.81
PRK13304 265 L-aspartate dehydrogenase; Reviewed 97.81
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 97.8
PRK08291330 ectoine utilization protein EutC; Validated 97.8
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 97.79
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 97.78
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 97.78
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 97.78
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.77
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 97.77
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 97.77
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 97.77
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 97.77
PRK07589346 ornithine cyclodeaminase; Validated 97.76
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 97.76
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 97.76
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 97.75
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 97.74
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 97.74
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.73
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 97.73
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 97.73
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.73
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.72
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.72
PRK14030445 glutamate dehydrogenase; Provisional 97.71
PLN02477410 glutamate dehydrogenase 97.7
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 97.69
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 97.69
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 97.68
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 97.68
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.68
PRK14031444 glutamate dehydrogenase; Provisional 97.68
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 97.65
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 97.65
PF02153 258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 97.65
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 97.63
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 97.62
PRK06719157 precorrin-2 dehydrogenase; Validated 97.62
PRK09414445 glutamate dehydrogenase; Provisional 97.62
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 97.62
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.58
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 97.57
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 97.57
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 97.56
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 97.56
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.55
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 97.54
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.54
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 97.53
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 97.51
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.49
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 97.48
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 97.47
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 97.47
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 97.46
PRK13771334 putative alcohol dehydrogenase; Provisional 97.46
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 97.45
PRK06199379 ornithine cyclodeaminase; Validated 97.45
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 97.44
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 97.43
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 97.41
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.41
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.41
PTZ00431 260 pyrroline carboxylate reductase; Provisional 97.39
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 97.38
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 97.37
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 97.36
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 97.36
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.36
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 97.36
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 97.34
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 97.32
PTZ00117 319 malate dehydrogenase; Provisional 97.3
cd08252336 AL_MDR Arginate lyase and other MDR family members 97.3
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.29
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 97.28
KOG1197|consensus336 97.28
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 97.28
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 97.27
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 97.26
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 97.25
PRK12861 764 malic enzyme; Reviewed 97.25
PLN02353 473 probable UDP-glucose 6-dehydrogenase 97.25
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 97.23
PTZ00082 321 L-lactate dehydrogenase; Provisional 97.22
PRK04148134 hypothetical protein; Provisional 97.22
PRK12862 763 malic enzyme; Reviewed 97.22
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 97.21
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 97.21
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.21
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.2
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.18
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.17
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.17
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 97.15
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.14
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.14
PRK05562223 precorrin-2 dehydrogenase; Provisional 97.13
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.11
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 97.1
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.1
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 97.09
COG0281432 SfcA Malic enzyme [Energy production and conversio 97.09
PRK06223 307 malate dehydrogenase; Reviewed 97.09
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 97.09
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 97.08
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 97.08
PRK00048 257 dihydrodipicolinate reductase; Provisional 97.07
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 97.07
PRK10637 457 cysG siroheme synthase; Provisional 97.07
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 97.07
PRK08300 302 acetaldehyde dehydrogenase; Validated 97.05
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 97.04
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 97.04
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 97.04
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.02
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.02
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 97.02
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 97.02
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 97.01
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.01
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 97.0
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.99
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.98
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 96.98
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.97
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.97
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.96
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 96.95
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 96.94
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 96.92
PRK03659601 glutathione-regulated potassium-efflux system prot 96.91
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 96.91
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 96.91
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.9
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 96.89
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 96.88
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 96.87
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.85
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 96.85
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 96.85
PRK09496 453 trkA potassium transporter peripheral membrane com 96.84
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 96.84
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 96.84
PRK03562621 glutathione-regulated potassium-efflux system prot 96.83
PTZ00354334 alcohol dehydrogenase; Provisional 96.83
PRK08324 681 short chain dehydrogenase; Validated 96.83
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 96.82
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 96.82
PRK13303 265 L-aspartate dehydrogenase; Provisional 96.81
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 96.8
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 96.79
PRK10669558 putative cation:proton antiport protein; Provision 96.78
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.77
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 96.77
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 96.77
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.76
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 96.73
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 96.73
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.7
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 96.69
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.68
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 96.66
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 96.65
COG5322351 Predicted dehydrogenase [General function predicti 96.65
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.64
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 96.63
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 96.62
PRK06444197 prephenate dehydrogenase; Provisional 96.62
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 96.61
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 96.61
KOG1198|consensus347 96.6
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.57
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.57
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.54
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 96.53
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 96.53
cd08251303 polyketide_synthase polyketide synthase. Polyketid 96.52
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.52
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.52
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 96.51
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 96.5
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 96.5
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 96.5
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 96.5
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.49
PRK12814 652 putative NADPH-dependent glutamate synthase small 96.49
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.47
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 96.45
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 96.44
PRK08265 261 short chain dehydrogenase; Provisional 96.43
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.43
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 96.42
PRK13529563 malate dehydrogenase; Provisional 96.4
PRK08223 287 hypothetical protein; Validated 96.39
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.38
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.38
PRK05086 312 malate dehydrogenase; Provisional 96.37
KOG2304|consensus 298 96.32
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 96.31
PLN02602 350 lactate dehydrogenase 96.3
KOG0399|consensus 2142 96.3
COG2130340 Putative NADP-dependent oxidoreductases [General f 96.28
PRK11579 346 putative oxidoreductase; Provisional 96.28
PRK09496453 trkA potassium transporter peripheral membrane com 96.28
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.28
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.27
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 96.26
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.26
PLN02527306 aspartate carbamoyltransferase 96.21
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 96.21
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 96.19
PLN02342348 ornithine carbamoyltransferase 96.18
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.18
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 96.18
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.16
PLN03129581 NADP-dependent malic enzyme; Provisional 96.12
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.11
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 96.06
PRK07806248 short chain dehydrogenase; Provisional 96.05
COG0673 342 MviM Predicted dehydrogenases and related proteins 96.05
PTZ00317559 NADP-dependent malic enzyme; Provisional 96.02
PLN03209 576 translocon at the inner envelope of chloroplast su 95.98
CHL00194 317 ycf39 Ycf39; Provisional 95.98
PRK06182 273 short chain dehydrogenase; Validated 95.96
PRK05993 277 short chain dehydrogenase; Provisional 95.96
PRK05693 274 short chain dehydrogenase; Provisional 95.93
PRK02255338 putrescine carbamoyltransferase; Provisional 95.91
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 95.9
PRK12742237 oxidoreductase; Provisional 95.9
PRK00779304 ornithine carbamoyltransferase; Provisional 95.9
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 95.87
PRK01713334 ornithine carbamoyltransferase; Provisional 95.83
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 95.81
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 95.81
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 95.79
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 95.78
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 95.78
PRK05866 293 short chain dehydrogenase; Provisional 95.77
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 95.77
PRK07326237 short chain dehydrogenase; Provisional 95.76
PTZ00325 321 malate dehydrogenase; Provisional 95.75
PRK04284332 ornithine carbamoyltransferase; Provisional 95.75
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.75
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.74
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 95.73
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
Probab=99.95  E-value=3e-28  Score=219.47  Aligned_cols=199  Identities=18%  Similarity=0.229  Sum_probs=155.1

Q ss_pred             CCCCCceEECChhhhHHHHhcccCccccccccCCHHHHHhhhcccCCCCCcchhhhccCcCcccCCCEEEEEcCchHHHH
Q psy16115         44 GRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKG  123 (258)
Q Consensus        44 ~~~~~~V~~lP~~~~~~vA~l~i~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~l~g~~V~IiG~G~IG~~  123 (258)
                      .+.++.|+++|++.+++||++++.+++...|++.+...    ..+.|.|.... ......+.++.|||+||+|+|+||+.
T Consensus        86 ~~~gI~Vtnvp~~~t~sVAe~~~aLiLa~~R~~~~~~~----~~r~g~w~~~~-~~~~~~~~~l~gktvGIiG~GrIG~a  160 (324)
T COG1052          86 KERGITVTNVPGYSTEAVAEHAVALILALARRIHEGDR----RVREGNWSLSG-GPDPLLGFDLRGKTLGIIGLGRIGQA  160 (324)
T ss_pred             HHCCcEEEeCCCCCchHHHHHHHHHHHHHhhchHHHHH----HHhcCcccccC-CcccccccCCCCCEEEEECCCHHHHH
Confidence            34589999999999999999999999999999876443    24556664432 11122356789999999999999999


Q ss_pred             HHHHHHhCCCEEEEEeCChhhHHHHHhCCCcccCHHHHHHhCCeeeec----cCccccccHHHHhcCCCCcEEEecCCC-
Q psy16115        124 CCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTA----TGNKNVVTREHMDKMKNGCVVCNMGHS-  198 (258)
Q Consensus       124 ~a~~l~~~G~~Vi~~d~~~~~~~~a~~~g~~~~~l~e~~~~aDvvi~~----~~~~~~i~~~~l~~~k~g~~ivnvg~~-  198 (258)
                      +|+++++|||+|++||+++. .+...+.++.+.++++++++||+|++|    ..|.++|+++.|++||+|+++||+||| 
T Consensus       161 vA~r~~~Fgm~v~y~~~~~~-~~~~~~~~~~y~~l~ell~~sDii~l~~Plt~~T~hLin~~~l~~mk~ga~lVNtaRG~  239 (324)
T COG1052         161 VARRLKGFGMKVLYYDRSPN-PEAEKELGARYVDLDELLAESDIISLHCPLTPETRHLINAEELAKMKPGAILVNTARGG  239 (324)
T ss_pred             HHHHHhcCCCEEEEECCCCC-hHHHhhcCceeccHHHHHHhCCEEEEeCCCChHHhhhcCHHHHHhCCCCeEEEECCCcc
Confidence            99999999999999999886 334445567888899999999999997    378899999999999999999999999 


Q ss_pred             --ChhhchhhhcCCCceeeeeccCcceee-cCCCcc--CCCceeEEecCCChhHHHH
Q psy16115        199 --NTEIDVNSLRTPDLTWEKVRSQVDHVI-WPDVNL--KNNTVIDLFRKPKSRLYLE  250 (258)
Q Consensus       199 --~~~~~~~~l~~~~i~~~~~~~~~~~~~-~~~~~l--~~~~~~~l~~~~~~~~~~~  250 (258)
                        |+++++++|++|+|...++..+..+-. ....++  .+.+.+  +-.||.++++.
T Consensus       240 ~VDe~ALi~AL~~g~i~gaglDV~e~Ep~~~d~~l~~l~~~~~v--vltPHia~at~  294 (324)
T COG1052         240 LVDEQALIDALKSGKIAGAGLDVFENEPALFDHPLLRLDNFPNV--VLTPHIASATE  294 (324)
T ss_pred             ccCHHHHHHHHHhCCcceEEeeecCCCCCCCChhHhhccCCCCE--EEccccccccH
Confidence              999999999999998877755443311 122222  221112  22688887764



>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>KOG0067|consensus Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG4230|consensus Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>KOG0089|consensus Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PF05221 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; InterPro: IPR000043 Adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, 3 Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
3mtg_A444 Crystal Structure Of Human S-Adenosyl Homocysteine 2e-65
3gvp_A435 Human Sahh-Like Domain Of Human Adenosylhomocystein 2e-64
3d64_A494 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-39
3n58_A464 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-38
1v8b_A479 Crystal Structure Of A Hydrolase Length = 479 3e-34
3ond_A488 Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Ho 3e-33
3dhy_A495 Crystal Structures Of Mycobacterium Tuberculosis S- 5e-33
3ce6_A494 Crystal Structure Of Mycobacterium Tuberculosis S-A 5e-33
3h9u_A436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 6e-30
1b3r_A431 Rat Liver S-Adenosylhomocystein Hydrolase Length = 1e-28
1xwf_A431 K185n Mutated S-adenosylhomocysteine Hydrolase Leng 1e-28
3nj4_A435 Fluoro-Neplanocin A In Human S-Adenosylhomocysteine 3e-28
1li4_A432 Human S-Adenosylhomocysteine Hydrolase Complexed Wi 3e-28
1d4f_A431 Crystal Structure Of Recombinant Rat-Liver D244e Mu 4e-28
3g1u_A437 Crystal Structure Of Leishmania Major S- Adenosylho 8e-28
1a7a_A432 Structure Of Human Placental S-adenosylhomocysteine 1e-25
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure

Iteration: 1

Score = 245 bits (626), Expect = 2e-65, Method: Compositional matrix adjust. Identities = 110/130 (84%), Positives = 122/130 (93%) Query: 99 LKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKL 158 LKR+TDVMFGGKQVV+CGYGEVGKGCC +LK LG ++YITEIDPICALQACMDGF VVKL Sbjct: 215 LKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKL 274 Query: 159 NEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVR 218 NEVIR VD+V+T TGNKNVVTREH+D+MKN C+VCNMGHSNTEIDV SLRTP+LTWE+VR Sbjct: 275 NEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVR 334 Query: 219 SQVDHVIWPD 228 SQVDHVIWPD Sbjct: 335 SQVDHVIWPD 344
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3D64|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Burkholderia Pseudomallei Length = 494 Back     alignment and structure
>pdb|3N58|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Brucella Melitensis In Ternary Complex With Nad And Adenosine, Orthorhombic Form Length = 464 Back     alignment and structure
>pdb|1V8B|A Chain A, Crystal Structure Of A Hydrolase Length = 479 Back     alignment and structure
>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Homocysteine Hydrolase In Complex With Adenosine Length = 488 Back     alignment and structure
>pdb|3DHY|A Chain A, Crystal Structures Of Mycobacterium Tuberculosis S-Adenosyl- Homocysteine Hydrolase In Ternary Complex With Substrate An Inhibitors Length = 495 Back     alignment and structure
>pdb|3CE6|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis S-Adenosyl-L- Homocysteine Hydrolase In Ternary Complex With Nad And Adenosine Length = 494 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|1B3R|A Chain A, Rat Liver S-Adenosylhomocystein Hydrolase Length = 431 Back     alignment and structure
>pdb|1XWF|A Chain A, K185n Mutated S-adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|3NJ4|A Chain A, Fluoro-Neplanocin A In Human S-Adenosylhomocysteine Hydrolase Length = 435 Back     alignment and structure
>pdb|1LI4|A Chain A, Human S-Adenosylhomocysteine Hydrolase Complexed With Neplanocin Length = 432 Back     alignment and structure
>pdb|1D4F|A Chain A, Crystal Structure Of Recombinant Rat-Liver D244e Mutant S- Adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 6e-82
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 2e-27
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 2e-79
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 3e-25
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 2e-74
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 2e-32
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 2e-69
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 4e-32
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 1e-68
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 3e-33
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 2e-68
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 2e-33
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 2e-65
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 7e-34
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 3e-18
2rir_A300 Dipicolinate synthase, A chain; structural genomic 5e-08
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 2e-05
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 3e-05
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 4e-05
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 8e-05
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 4e-04
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 5e-04
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 8e-04
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 8e-04
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 8e-04
3c85_A183 Putative glutathione-regulated potassium-efflux S 9e-04
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
 Score =  251 bits (643), Expect = 6e-82
 Identities = 115/178 (64%), Positives = 135/178 (75%), Gaps = 28/178 (15%)

Query: 98  SLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVK 157
            LKR+TD+MFGGKQVV+CGYGEVGKGCC +LK +G ++Y+TEIDPICALQACMDGF +VK
Sbjct: 209 GLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVK 268

Query: 158 LNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKV 217
           LNEVIR VDIV+T TGNKNVVTREH+D+MKN C+VCNMGHSNTEIDV SLRTP+LTWE+V
Sbjct: 269 LNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERV 328

Query: 218 RSQVDHVIWPD------------VNLKNNTV----------------IDLFRKPKSRL 247
           RSQVDHVIWPD            +NL  +TV                I+L+  P+ R 
Sbjct: 329 RSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRY 386


>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Length = 234 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Length = 141 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Length = 183 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.92
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.91
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.91
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.91
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.91
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.91
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.9
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.9
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.9
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.89
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.89
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 99.89
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.89
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.89
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.89
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.88
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.88
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.88
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 99.87
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.87
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.87
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.87
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 99.87
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.86
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.86
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.86
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 99.85
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.85
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.85
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.84
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.84
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.83
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.83
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.83
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 99.83
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.82
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.82
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.81
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 99.79
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 99.78
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 99.7
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 99.62
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.62
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.5
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 99.44
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 99.43
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 99.42
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 99.41
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 99.41
3l07_A285 Bifunctional protein fold; structural genomics, ID 99.4
3p2o_A285 Bifunctional protein fold; structural genomics, ce 99.39
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 99.39
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 99.38
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 99.38
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 99.37
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 99.37
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.36
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 99.33
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 99.33
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 99.32
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 99.3
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.3
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.28
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.25
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.24
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.24
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 99.21
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.21
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 99.2
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.2
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 99.19
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.19
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.17
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.17
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.17
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 99.15
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.15
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 99.15
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 99.14
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.13
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 99.13
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 99.13
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.12
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.11
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.1
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.09
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 99.08
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 99.05
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.03
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.0
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 99.0
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.99
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 98.99
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 98.99
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 98.98
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.98
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.97
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 98.97
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 98.97
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 98.96
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 98.96
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 98.96
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.95
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 98.95
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 98.95
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 98.95
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.93
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 98.93
3krt_A456 Crotonyl COA reductase; structural genomics, prote 98.92
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.92
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 98.92
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.91
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 98.9
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 98.9
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 98.9
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 98.88
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 98.88
3qha_A 296 Putative oxidoreductase; seattle structural genomi 98.87
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.87
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 98.86
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.85
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 98.85
3fbg_A346 Putative arginate lyase; structural genomics, unkn 98.85
4eye_A342 Probable oxidoreductase; structural genomics, niai 98.83
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 98.82
4ezb_A 317 Uncharacterized conserved protein; structural geno 98.82
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 98.81
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 98.81
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 98.81
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.8
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.79
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 98.78
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.75
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 98.74
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.74
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 98.73
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 98.73
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.73
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 98.72
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 98.72
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 98.72
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 98.72
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 98.71
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 98.7
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.7
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 98.7
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 98.7
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 98.7
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 98.69
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 98.68
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 98.68
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.68
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 98.67
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 98.67
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.11
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 98.65
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 98.65
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 98.64
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 98.63
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 98.63
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 98.63
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 98.61
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 98.6
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 98.59
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 98.58
3gms_A340 Putative NADPH:quinone reductase; structural genom 98.58
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.57
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.56
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 98.55
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 98.53
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 98.53
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 98.5
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 98.49
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 98.49
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 98.48
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 98.48
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 98.47
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 98.47
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.47
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 98.46
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 98.46
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 98.45
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 98.44
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 98.43
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 98.42
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.41
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 98.39
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.37
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 98.37
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 98.37
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.35
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 98.34
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.34
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 98.33
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 98.32
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 98.32
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 98.32
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 98.31
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 98.31
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.31
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 98.3
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.29
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 98.29
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 98.29
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 98.29
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 98.28
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 98.27
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.27
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 98.27
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 98.27
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 98.27
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 98.26
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 98.24
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.24
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 98.23
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 98.23
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.23
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 98.22
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 98.22
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 98.22
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.21
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 98.21
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.2
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 98.19
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 98.19
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.19
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.18
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.16
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.15
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 98.15
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 98.14
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.14
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 98.1
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 98.09
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 98.08
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.08
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 98.07
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.07
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.06
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 98.05
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.04
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 98.03
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.01
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 98.0
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.99
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 97.98
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 97.98
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.97
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 97.94
2i76_A 276 Hypothetical protein; NADP, dehydrogenase, TM1727, 97.94
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 97.92
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 97.9
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 97.9
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 97.9
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.89
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.83
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 97.82
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.78
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 97.76
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.76
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 97.74
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.74
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.7
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 97.7
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 97.7
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.66
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.61
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.61
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.6
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 97.59
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 97.58
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 97.57
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.56
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.56
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 97.55
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.54
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 97.53
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 97.53
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.52
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.52
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 97.52
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 97.51
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.51
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 97.51
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.51
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.49
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.48
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.47
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.47
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.45
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.45
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 97.44
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 97.43
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 97.43
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.43
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 97.41
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.41
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.4
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.4
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.4
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 97.39
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.39
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.38
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 97.36
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.36
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 97.35
3tl2_A 315 Malate dehydrogenase; center for structural genomi 97.35
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.33
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.32
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.32
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.32
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 97.31
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.31
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.31
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.29
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.28
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.27
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.26
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.26
2duw_A145 Putative COA-binding protein; ligand binding prote 97.25
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.24
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.24
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 97.22
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 97.21
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 97.21
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 97.21
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 97.2
1ydw_A 362 AX110P-like protein; structural genomics, protein 97.19
4eso_A255 Putative oxidoreductase; NADP, structural genomics 97.18
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.18
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.17
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.17
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 97.15
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.15
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.15
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.15
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 97.15
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.13
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 97.12
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.12
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.12
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.12
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.11
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.1
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 97.1
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 97.1
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 97.08
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 97.07
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 97.07
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 97.07
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 97.07
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.06
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.06
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.06
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 97.05
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.05
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.01
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 97.0
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 97.0
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 96.99
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 96.99
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.98
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.97
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 96.97
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 96.97
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 96.97
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.96
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 96.95
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 96.94
4had_A 350 Probable oxidoreductase protein; structural genomi 96.92
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 96.92
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.92
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.9
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 96.88
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 96.86
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 96.86
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 96.86
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 96.86
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 96.86
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 96.85
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.85
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 96.84
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 96.84
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.84
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.83
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 96.83
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 96.82
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.81
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 96.81
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 96.81
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 96.8
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 96.79
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.78
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 96.77
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 96.77
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 96.76
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 96.76
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 96.75
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 96.74
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 96.74
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 96.74
4g65_A 461 TRK system potassium uptake protein TRKA; structur 96.74
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 96.73
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.72
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 96.71
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 96.7
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 96.66
1lnq_A336 MTHK channels, potassium channel related protein; 96.65
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 96.64
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 96.64
1xhl_A 297 Short-chain dehydrogenase/reductase family member 96.64
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 96.63
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 96.63
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 96.63
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 96.61
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 96.6
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 96.6
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 96.59
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.59
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 96.57
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 96.57
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 96.55
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.54
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.53
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 96.52
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 96.52
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.51
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 96.51
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 96.5
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 96.49
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.49
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 96.48
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 96.48
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 96.48
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 96.48
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 96.48
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 96.48
4h3v_A 390 Oxidoreductase domain protein; structural genomics 96.47
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.47
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 96.46
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.45
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.45
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 96.45
1xq6_A253 Unknown protein; structural genomics, protein stru 96.45
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.44
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 96.44
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 96.44
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 96.43
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 96.43
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 96.42
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 96.42
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 96.4
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 96.4
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 96.4
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 96.39
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.39
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 96.39
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 96.39
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 96.38
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 96.38
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.37
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.37
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 96.36
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 96.35
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 96.35
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 96.34
4dqx_A277 Probable oxidoreductase protein; structural genomi 96.34
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 96.33
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 96.32
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.32
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 96.31
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 96.31
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.31
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 96.3
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.26
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.26
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.26
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 96.25
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 96.25
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.24
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 96.24
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 96.23
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.22
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.21
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 96.2
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 96.2
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 96.2
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.19
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.19
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 96.19
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.19
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 96.19
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 96.18
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.18
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.18
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.17
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 96.17
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 96.17
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 96.17
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 96.16
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
Probab=99.92  E-value=5.4e-26  Score=205.20  Aligned_cols=163  Identities=13%  Similarity=0.138  Sum_probs=136.4

Q ss_pred             CCceEECChhhhHHHHhcccCccccccccCCHHHHHhhhcccCCCCCcchhhhccCcCcccCCCEEEEEcCchHHHHHHH
Q psy16115         47 KSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSLKRSTDVMFGGKQVVLCGYGEVGKGCCQ  126 (258)
Q Consensus        47 ~~~V~~lP~~~~~~vA~l~i~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~l~g~~V~IiG~G~IG~~~a~  126 (258)
                      ++.|+++|++.+.++||+++.+++...|++.....    ..+.|.|....    ...+.++.|+|+||+|+|.||+.+|+
T Consensus        87 gI~v~n~p~~~~~~vAE~~~~l~L~~~r~~~~~~~----~~~~~~~~~~~----~~~~~~l~g~tvGIiG~G~IG~~va~  158 (334)
T 3kb6_A           87 GILVTHIPAYSPESVAEHTFAMILTLVKRLKRIED----RVKKLNFSQDS----EILARELNRLTLGVIGTGRIGSRVAM  158 (334)
T ss_dssp             TCEEECCTTSCHHHHHHHHHHHHHHHHTTHHHHHH----HHHTTCCCCCG----GGCBCCGGGSEEEEECCSHHHHHHHH
T ss_pred             CCEEEECCCcCcHHHHHHHHHHHHHHhhccccccc----ccccccccccc----ccccceecCcEEEEECcchHHHHHHH
Confidence            88999999999999999999998888888765332    22334443221    11245789999999999999999999


Q ss_pred             HHHhCCCEEEEEeCChhhHHHHHhCCCcccCHHHHHHhCCeeeec----cCccccccHHHHhcCCCCcEEEecCCC---C
Q psy16115        127 SLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTA----TGNKNVVTREHMDKMKNGCVVCNMGHS---N  199 (258)
Q Consensus       127 ~l~~~G~~Vi~~d~~~~~~~~a~~~g~~~~~l~e~~~~aDvvi~~----~~~~~~i~~~~l~~~k~g~~ivnvg~~---~  199 (258)
                      ++++||++|++||+.+..  ...+.++...++++++++||+|++|    ..|.++|+++.|+.||+|+++||+|||   |
T Consensus       159 ~~~~fg~~v~~~d~~~~~--~~~~~~~~~~~l~ell~~sDivslh~Plt~~T~~li~~~~l~~mk~~a~lIN~aRG~iVd  236 (334)
T 3kb6_A          159 YGLAFGMKVLCYDVVKRE--DLKEKGCVYTSLDELLKESDVISLHVPYTKETHHMINEERISLMKDGVYLINTARGKVVD  236 (334)
T ss_dssp             HHHHTTCEEEEECSSCCH--HHHHTTCEECCHHHHHHHCSEEEECCCCCTTTTTCBCHHHHHHSCTTEEEEECSCGGGBC
T ss_pred             hhcccCceeeecCCccch--hhhhcCceecCHHHHHhhCCEEEEcCCCChhhccCcCHHHHhhcCCCeEEEecCcccccc
Confidence            999999999999987643  3345677888999999999999998    378899999999999999999999999   9


Q ss_pred             hhhchhhhcCCCceeeeecc
Q psy16115        200 TEIDVNSLRTPDLTWEKVRS  219 (258)
Q Consensus       200 ~~~~~~~l~~~~i~~~~~~~  219 (258)
                      +++++++|++|+|...++..
T Consensus       237 e~aL~~aL~~g~i~gA~LDV  256 (334)
T 3kb6_A          237 TDALYRAYQRGKFSGLGLDV  256 (334)
T ss_dssp             HHHHHHHHHTTCEEEEEESC
T ss_pred             HHHHHHHHHhCCceEEEEeC
Confidence            99999999999998776643



>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 258
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 2e-51
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 1e-42
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 3e-28
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 2e-24
d2fy8a1129 c.2.1.9 (A:116-244) Potassium channel-related prot 2e-05
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 5e-05
d1id1a_153 c.2.1.9 (A:) Rck domain from putative potassium ch 2e-04
d2hmva1134 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T 3e-04
d1leha1230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 5e-04
d1lssa_132 c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus ja 0.002
d2naca2186 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenas 0.004
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: S-adenosylhomocystein hydrolase
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]
 Score =  163 bits (413), Expect = 2e-51
 Identities = 69/132 (52%), Positives = 91/132 (68%), Gaps = 1/132 (0%)

Query: 98  SLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVK 157
            L R+TD +  GK VV+CGYG+VGKGC  S+KGLG  +YITEIDPICA+QA M+GF+VV 
Sbjct: 12  GLMRATDFLISGKIVVICGYGDVGKGCASSMKGLGARVYITEIDPICAIQAVMEGFNVVT 71

Query: 158 LNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRT-PDLTWEK 216
           L+E++   D  +T TGN +V+  EH+ KMKN  VV N+GH + EI VN L     +  E 
Sbjct: 72  LDEIVDKGDFFITCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNELFNYKGIHIEN 131

Query: 217 VRSQVDHVIWPD 228
           V+ QVD +  P+
Sbjct: 132 VKPQVDRITLPN 143


>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 129 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 132 Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.93
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 99.92
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.91
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.91
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.91
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 99.9
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.9
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.88
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.88
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.85
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.58
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.57
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.24
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.24
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.2
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 99.19
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.15
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.15
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 99.15
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.14
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.13
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.12
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.08
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.08
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 99.07
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.05
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.05
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 99.03
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.02
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 98.99
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 98.97
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.9
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.89
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.87
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.86
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.86
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 98.84
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 98.81
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.78
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.75
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.73
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.7
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.65
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 98.65
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.63
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 98.63
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 98.61
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.61
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 98.58
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 98.57
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 98.56
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 98.55
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 98.55
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 98.47
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.45
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 98.43
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 98.37
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.33
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 98.28
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 98.24
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.24
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.23
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 98.22
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.18
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.16
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.11
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.11
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.09
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.06
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 98.02
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 97.92
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.91
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.9
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.84
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 97.82
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 97.79
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 97.79
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 97.75
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.75
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.74
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.72
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.72
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.7
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.69
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 97.67
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 97.66
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.66
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.65
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.65
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.65
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.61
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.59
d1v8ba2313 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.56
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.56
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.54
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 97.54
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.52
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 97.5
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.49
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.47
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.44
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.4
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 97.38
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.34
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.33
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.32
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.28
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.28
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.26
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 97.24
d1li4a2267 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.22
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.21
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.21
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.19
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.18
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.18
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.18
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.16
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.15
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.1
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.09
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 97.09
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.08
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.06
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 97.04
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 96.97
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.96
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.96
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 96.96
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 96.91
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.89
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 96.89
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.88
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.88
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 96.87
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 96.87
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.85
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.83
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 96.79
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.79
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.78
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.76
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 96.76
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.76
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.74
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.72
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 96.72
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.71
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.71
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 96.71
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.7
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.69
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.69
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.68
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.67
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 96.66
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.64
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.64
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.62
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.62
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 96.62
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 96.61
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.61
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.6
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.6
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.59
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 96.59
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 96.59
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.57
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.57
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.56
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 96.54
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.53
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 96.51
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.51
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.51
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.5
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 96.46
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.46
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.45
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 96.45
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.42
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.42
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 96.41
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.41
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 96.4
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.39
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.37
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.37
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 96.37
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.36
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.36
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.33
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.3
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 96.29
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 96.29
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 96.25
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 96.24
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.19
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 96.15
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.1
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.07
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.01
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 96.0
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.97
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.97
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 95.94
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 95.93
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.89
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.85
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.83
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.82
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 95.77
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 95.73
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 95.71
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 95.7
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 95.67
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 95.59
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.58
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.5
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 95.48
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 95.48
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 95.47
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.46
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 95.32
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 95.3
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 95.29
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 95.18
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.17
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 95.15
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 95.07
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 95.04
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 94.99
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 94.97
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.96
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.96
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.93
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 94.92
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 94.82
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 94.81
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.8
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 94.79
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 94.73
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 94.7
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.69
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 94.64
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 94.62
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.6
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.58
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 94.57
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 94.5
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.46
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.46
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 94.45
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.45
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.37
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 94.35
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 94.23
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 94.2
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 94.19
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.18
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 94.17
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 94.15
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.15
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 94.12
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 94.11
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 94.1
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.06
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 94.05
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 94.04
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 94.04
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 94.04
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 94.0
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 93.99
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 93.99
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.98
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.98
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 93.95
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 93.92
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 93.91
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 93.9
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 93.82
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 93.82
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 93.78
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 93.65
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 93.63
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 93.61
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.6
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 93.59
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 93.57
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 93.53
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 93.38
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 93.31
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.24
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 93.06
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 93.03
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 92.99
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 92.98
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 92.97
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 92.97
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 92.9
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.89
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 92.86
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 92.86
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 92.85
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 92.84
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 92.84
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 92.79
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 92.78
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 92.76
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.46
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 92.37
d1js1x2161 Transcarbamylase-like protein {Bacteroides fragili 92.29
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 92.24
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.23
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 92.14
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 92.13
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.05
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 92.04
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 91.94
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 91.75
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 91.72
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 91.72
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 91.66
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 91.56
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 91.51
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 91.4
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 91.3
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.13
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.1
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 90.9
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 90.88
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 90.87
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.86
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 90.6
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 90.56
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 90.49
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 90.47
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 90.44
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 90.36
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 90.34
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 90.33
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 90.19
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 90.15
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 89.89
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.82
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 89.67
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 89.66
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 89.61
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 89.52
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.37
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 89.34
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 89.33
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 89.04
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.77
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 88.39
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 88.25
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 88.16
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 87.63
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 87.54
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 87.27
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 87.11
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 86.84
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 86.82
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 86.66
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 86.65
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 86.59
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 86.46
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 86.2
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 86.1
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 85.47
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 85.33
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 85.31
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 84.83
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 84.82
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 84.79
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 84.66
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 84.62
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 84.56
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 84.39
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 83.67
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 83.19
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 83.12
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 82.53
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 82.45
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 82.39
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 82.07
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 82.02
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 81.9
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 81.86
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 81.62
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 81.18
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 81.02
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 80.98
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 80.55
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 80.44
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 80.44
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 80.1
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: Transcription corepressor CtbP
species: Human (Homo sapiens), Ctbp1 [TaxId: 9606]
Probab=99.93  E-value=5.4e-26  Score=188.21  Aligned_cols=182  Identities=14%  Similarity=0.170  Sum_probs=138.3

Q ss_pred             HHHHhcccCccccccccCCHHHHHhhhcccCCCCCcchhhh--ccCcCcccCCCEEEEEcCchHHHHHHHHHHhCCCEEE
Q psy16115         59 EYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSL--KRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIY  136 (258)
Q Consensus        59 ~~vA~l~i~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~--~~~~~~~l~g~~V~IiG~G~IG~~~a~~l~~~G~~Vi  136 (258)
                      ++|||+++.+++...|++.....    ..+.|.|.......  ....+.++.|+||||+|+|.||+.+|++++.|||+|+
T Consensus         1 e~VAE~ai~liL~l~R~i~~~~~----~~~~g~w~~~~~~~~~~~~~~~eL~gktvgIiG~G~IG~~va~~l~~fg~~v~   76 (193)
T d1mx3a1           1 EETADSTLCHILNLYRRATWLHQ----ALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVL   76 (193)
T ss_dssp             HHHHHHHHHHHHHHHHCHHHHHH----HHHTTCCCCSHHHHHHHTTTCCCCTTCEEEEECCSHHHHHHHHHHHTTTCEEE
T ss_pred             CcHHHHHHHHHHHHHhCHHHHHH----HHHcCCcccccccccccccCceeeeCceEEEeccccccccceeeeecccccee
Confidence            57999999999888888765432    23456665433211  1123567999999999999999999999999999999


Q ss_pred             EEeCChhhHHHHHhCCCc-ccCHHHHHHhCCeeeec----cCccccccHHHHhcCCCCcEEEecCCC---Chhhchhhhc
Q psy16115        137 ITEIDPICALQACMDGFS-VVKLNEVIRTVDIVVTA----TGNKNVVTREHMDKMKNGCVVCNMGHS---NTEIDVNSLR  208 (258)
Q Consensus       137 ~~d~~~~~~~~a~~~g~~-~~~l~e~~~~aDvvi~~----~~~~~~i~~~~l~~~k~g~~ivnvg~~---~~~~~~~~l~  208 (258)
                      +||++...... ...++. ..+++++++.||+|++|    ..|.++++++.|+.||+++++||+|||   |+++++++|+
T Consensus        77 ~~d~~~~~~~~-~~~~~~~~~~l~~ll~~sD~i~~~~plt~~T~~li~~~~l~~mk~~a~lIN~sRG~ivde~aL~~aL~  155 (193)
T d1mx3a1          77 FYDPYLSDGVE-RALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALK  155 (193)
T ss_dssp             EECTTSCTTHH-HHHTCEECSSHHHHHHHCSEEEECCCCCTTCTTSBSHHHHTTSCTTEEEEECSCTTSBCHHHHHHHHH
T ss_pred             eccCcccccch-hhhccccccchhhccccCCEEEEeecccccchhhhhHHHHhccCCCCeEEecCCceEEcHHHHHHHHH
Confidence            99987655332 223443 55899999999999997    368899999999999999999999999   9999999999


Q ss_pred             CCCceeeeeccCcce-eecCCCccCCCceeEEecCCChhH
Q psy16115        209 TPDLTWEKVRSQVDH-VIWPDVNLKNNTVIDLFRKPKSRL  247 (258)
Q Consensus       209 ~~~i~~~~~~~~~~~-~~~~~~~l~~~~~~~l~~~~~~~~  247 (258)
                      ++++...++....++ .+....++.+...+  +.+||++|
T Consensus       156 ~~~i~~a~lDV~~~EP~~~~~~~l~~~~nv--i~TPHiA~  193 (193)
T d1mx3a1         156 EGRIRGAALDVHESEPFSFSQGPLKDAPNL--ICTPHAAW  193 (193)
T ss_dssp             HTSEEEEEESCCSSSSCCTTSSTTTTCSSE--EECSSCTT
T ss_pred             cCCceEEEEEcCCCCCCCCCchhHHcCCCE--EEcCCcCc
Confidence            999977666443322 23334555555443  34799886



>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure