Diaphorina citri psyllid: psy16118


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070
MSPILQYIEVDNFKSYKGKFSIGPLKKFTAVIGPNGSGALKDDYERLKAEMIQAEEETNMSYLKKKGVVAERKEAKIEKDEAEKYQRIREEIVAKEVEHQLFKLYHNETDIKELEDELDKKKGEVEKIERRKEKAENILREKKKEQGALNRELAKVDQEIREMDVEINKKRPSLIKSKERVSHIQKKLASAKKSLVEVRQANEAHNKDIADLETQLADVRKRKAEYERQSIPGRDINLESAQDVEINKKRPSLIKSKERVSHIQKKLASAKKSLVEVRQANEAHNKDIADLETQLADVRKRKAEYERQSIPGRDINLESAQMTEYTNLKAEATKRAGKILQQLDTINREQKGDQDKLDNELRQQVQTQNEIKKKRHEMEEAQKRIDKLEDHIRQNEASLKDNKKLKEELNSDVGSSKNRVQELQKELEQVIEELGDAKTDKHEDTRRKKKQELVENFKKAYSGVYDRMINMCHPVHKRYNVAITKVLGKYMEAIVVDSEKTARLCIQYLKDHQLDPETFLPIDYLQTKPLKERLRNIRDPKNVKLLYDVLKYQPEDIKRVVLFATNNALVCETPEDAMKVAYDIEPQHRYDAVALDGTFYQKSGIMSGGSLDLARKAKRWDDKEMGNLKAQKEKLSEELREAMKKSRKESELNTVQSTIKGLEIRLNYSRQDLQNTKSQIAKLEAEIDALNARADATEPKIKAIEASMTARGDTISRKKEEMNSVEDIVFRDFCKSIGVSTIRQYEEAELRSQQERQKICQDKDTKKNVARWERAVSDDEEELARAQGAEEKLAGEMRAEADKLENMRATRLTKKQAVDAMDEEIGKARREVGSIAKDIQAAQKSCVNLESKLEMKKSERHDILMNCKMNDIVLPMLRVQKYDRKLAKSIQEMTSRLQTIQAPNLRAMEKLEHAKENLMKTNEEFENARKRAKKAKANFDRIKKERYDKFTRCFEHVSNEIDGAGSESVLPRPFLGPENPEEPLTYRVSTTIVSHRYHPAPFFVLDEIDAALDNTNIGKVASYIVTKTQDSLQTIVISLKEEFFSHADSLVGICPGSVTISSICFGHYSM
ccccccHHEEcccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHccccccccHHHHHHHHHHHccccccEEEccHHHHHHHHHHHHHcccccccECcccccccccccHHHHcccccccccccccccccccHHHHHHHHHHHccCEEEccHHHHHHHHHHccccccEEEEEEccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHccccccccccCEEEEccccc
*SPILQYIEVDNFKSYKGKFSIGPLKKFTAVIGPNGSGALKDDYER****************************************RIREEIVAKEVEHQLFKLYHNETDIKELEDELD****************************ALNRELAKVDQEIREMDVEINKKRPSLIKSKERVSHIQKKLA************************************************************************************************************************************************************************************************************************************************************************VENFKKAYSGVYDRMINMCHPVHKRYNVAITKVLGKYMEAIVVDSEKTARLCIQYLKDHQLDPETFLPIDYLQTKPLKERLRNIRDPKNVKLLYDVLKYQPEDIKRVVLFATNNALVCETPEDAMKVAYDIEPQHRYDAVALDGTFYQKSGIMS******************************************************LEIRL**********************************************************VEDIVFRDFCKSIGVSTIRQY*****************************************************************************************************************ERHDILMNCKMNDIVLPMLRVQKYDRKLA**********QTIQAPNLRAMEKLEHAKENLMKTNEEFENARKRAKKAKANFDRIKKERYDKFTRCFEHVSNEIDGAGSES*************EPLTYRVSTTIVSHRYHPAPFFVLDEIDAALDNTNIGKVASYIVTKTQDSLQTIVISLKEEFFSHADSLVGICPGSVTISSICFGHY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPILQYIEVDNFKSYKGKFSIGPLKKFTAVIGPNGxxxxxxxxxxxxxxxxxxxxxTNMSYLKKKGVVAERKEAKIEKDEAEKYQRIREEIVAKEVEHQLFKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIREMDVEINKKRPSLIKSKERVSHIQKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSIPGRDINLESAQDVEINKKRPSLIKSKERVSHIQKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSIPGRDINLESAQMTEYTNLKAEATKRAGKILQQLDTINREQKGDQDKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKHEDTRRKKKQELVENFKKAYSGVYDRMINMCHPVHKRYNVAITKVLGKYMEAIVVDSEKTARLCIQYLKDHQLDPETFLPIDYLQTKPLKERLRNIRDPKNVKLLYDVLKYQPEDIKRVVLFATNNALVCETPEDAMKVAYDIEPQHRYDAVALDGTFYQKSGIMSGGSLDLARKAKRWDDKExxxxxxxxxxxxxxxxxxxxxxxxxxxxNTVQSTIKGLEIRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIKAIEASMTARGDTISRKKEEMNSVEDIVFRDFCKSIGVSTIRQYEEAELRSQQERQKICQDKDTKKNxxxxxxxxxxxxxxxxxxxxxEEKLAGEMRAEADKLENMRATRLTKKQAVDAMDEEIGKARREVGSIAKDxxxxxxxxxxxxxxxxxxxxxRHDILMNCKMNDIVLPMLRVQKYDRKLAKSIQEMTSRLQTIQAPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRYDKFTRCFEHVSNEIDGAGSESVLPRPFLGPENPEEPLTYRVSTTIVSHRYHPAPFFVLDEIDAALDNTNIGKVASYIVTKTQDSLQTIVISLKEEFFSHADSLVGICPGSVTISSICFGHYSM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Structural maintenance of chromosomes protein 1A Involved in chromosome cohesion during cell cycle and in DNA repair. Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, or via its phosphorylation by ATR. Works as a downstream effector both in the ATM/NBS1 branch and in the ATR/MSH2 branch of S-phase checkpoint.confidentQ9Z1M9
Structural maintenance of chromosomes protein 1A Involved in chromosome cohesion during cell cycle and in DNA repair. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, and works as a downstream effector in the ATM/NBS1 branch of S-phase checkpoint (By similarity). Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, or via its phosphorylation by ATR. Works as a downstream effector both in the ATM/NBS1 branch and in the ATR/MSH2 branch of S-phase checkpoint.confidentO97593
Structural maintenance of chromosomes protein 1A Involved in chromosome cohesion during cell cycle and in DNA repair. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, and works as a downstream effector in the ATM/NBS1 branch of S-phase checkpoint (By similarity). Central component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Involved in DNA repair via its interaction with BRCA1 and its related phosphorylation by ATM, or via its phosphorylation by ATR. Works as a downstream effector both in the ATM/NBS1 branch and in the ATR/MSH2 branch of S-phase checkpoint.confidentQ9CU62

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030893 [CC]meiotic cohesin complexprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0008278, GO:0044422
GO:0044454 [CC]nuclear chromosome partprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 110-146
View the alignment between query and template
View the model in PyMOL
Template: 2WD5, chain A
Confidence level:very confident
Coverage over the Query: 450-629
View the alignment between query and template
View the model in PyMOL
Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 918-940,953-1065
View the alignment between query and template
View the model in PyMOL
Template: 1W1W, chain A
Confidence level:very confident
Coverage over the Query: 3-38
View the alignment between query and template
View the model in PyMOL
Template: 2FXO, chain A
Confidence level:probable
Coverage over the Query: 109-226
View the alignment between query and template
View the model in PyMOL
Template: 3GHG, chain A
Confidence level:probable
Coverage over the Query: 763-869
View the alignment between query and template
View the model in PyMOL
Template: 3U1C, chain A
Confidence level:probable
Coverage over the Query: 339-418
View the alignment between query and template
View the model in PyMOL
Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 38-434
View the alignment between query and template
View the model in PyMOL
Template: 2XS1, chain A
Confidence level:probable
Coverage over the Query: 69-461
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 693-708
View the alignment between query and template
View the model in PyMOL