Diaphorina citri psyllid: psy16147


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MHQLFKPVSVYFMVLVKLKSRLMMSSNGTMSCADDNSGEGQFLCDQCDKVFAKHSSLARHKYEHSVLQKCSSSYNYPRHSICNRPTASYPELSDMGSLEGDESLDRMDEDSSERKLKSRLMMSSNGTMSCADDNSGEGQFLCDQCDKVFAKHSSLARHKYEHSGQRPYKCVECPKAFKHKHHLTEHKRLHSGEKPFQCCKCLKRFSHSGSYSQHMNHRYSYCKPYRE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MHQLFKPVSVYFMVLVKLKSRLMMSSNGTMSCADDNSGEGQFLCDQCDKVFAKHSSLARHKYEHSVLQKCSSSYNYPRHSICNRPTASYPELSDMGSLEGDESLDRMDEDSSERKLKSRLMMSSNGTMSCADDNSGEGQFLCDQCDKVFAKHSSLARHKYEHSGQRPYKCVECPKAFKHKHHLTEHKRLHSGEKPFQCCKCLKRFSHSGSYSQHMNHRYSYCKPY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHQLFKPVSVYFMVLVKLKSRLMMSSNGTMSCADDNSGEGQFLCDQCDKVFAKHSSLARHKYEHSVLQKCSSSYNYPRHSICNRPTASYPELSDMGSLEGDESLDRMDEDSSERKLKSRLMMSSNGTMSCADDNSGEGQFLCDQCDKVFAKHSSLARHKYEHSGQRPYKCVECPKAFKHKHHLTEHKRLHSGEKPFQCCKCLKRFSHSGSYSQHMNHRYSYCKPYRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger E-box-binding homebox protein zag-1 Down-regulates expression of genes involved in either the synthesis or reuptake of serotonin, dopamine and GABA. Acts as a transcriptional repressor to regulate multiple, discrete, neuron-specific aspects of terminal differentiation, including cell migration, axonal development and gene expression. Required for axon guidance. Involved in the proper development of the pharynx. Directly represses its own transcription by interacting with conserved E-box sequence motifs 5'-CACCTG-3' in its own promoter.very confidentG5EBU4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0045666 [BP]positive regulation of neuron differentiationprobableGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0070888 [MF]E-box bindingprobableGO:0044212, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0071230 [BP]cellular response to amino acid stimulusprobableGO:1901700, GO:0043200, GO:0051716, GO:0009719, GO:1901701, GO:1901698, GO:0071417, GO:1901699, GO:0008150, GO:0044699, GO:0071229, GO:0071495, GO:0071310, GO:0044763, GO:0001101, GO:0070887, GO:0050896, GO:0042221, GO:0009987, GO:0010243, GO:0010033
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 23-94,130-219
View the alignment between query and template
View the model in PyMOL
Template: 1TF6, chain A
Confidence level:very confident
Coverage over the Query: 39-219
View the alignment between query and template
View the model in PyMOL