Diaphorina citri psyllid: psy16151

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30

MLRLMMTSGQIVDIVQTLEDRVHHVLFKKPFYAKRAKNPYFPFCTQPSSSIVFLKLFLHYFICFKLVSKPAPFWQGTAVVDGQLKEIKLSDYYGKYLVFFFYPLDFTFVCPTEILAFNDRLEEFHQINTEVVAASVDSHFTHLAWVNTPRKEGGLGKLKIPLLSDLTHKISLDYGVYLSDQGHTLRGLFIIDRNGVLRQITMNDLPVGRSVDETLRLVQAFHDPLRTGAINGLSLLVIGLFQVTEKTCDILEDHGVTCELRGRTFIKGKGLITTYFIRQQEIEKFQKINIDSKSYMKIH

ccHHHHHHccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHccccHHHccccccccccEEEEEEccEEEEEEcccccccEEEEEEcccccCCcccccHHHHHHcHHHHHHcccEEEEEEcccHHHHHHHHcccccccccccccccccccccccHHHHcccccccccEEEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHcccccccccc

*******SGQIVDIVQTLEDRVHHVLFKKPFYAKRAKNPYFPFCTQ*******LKLFLHYFICFKLVSKPAPFWQGTAVVDGQLKEIKLSDYYGKYLVFFFYPLDFTFVCPTEILAFNDRLEEFHQINTEVVAASVDSHFTHLAWVNTPRKEGGLGKLKIPLLSDLTHKISLDYGVYLSDQGHTLRGLFIIDRNGVLRQITMNDLPVGRSVDETLRLVQAFHDPLRTGAINGLSLLVIGLFQVTEKTCDILEDHGVTCELRGRTFIKGKGLITTYFIRQQEIEKFQKINI****YM***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peroxiredoxin-4	Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.	confident	Q13162
Peroxiredoxin-4	Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.	confident	Q9BGI2
Peroxiredoxin-4	Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.	confident	Q9Z0V5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0072593 [BP]	reactive oxygen species metabolic process	confident	GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0005575 [CC]	cellular_component	confident
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030446 [CC]	hyphal cell wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0008379 [MF]	thioredoxin peroxidase activity	probable	GO:0016209, GO:0016705, GO:0051920, GO:0003824, GO:0003674, GO:0016684, GO:0004601, GO:0016491
GO:0019430 [BP]	removal of superoxide radicals	probable	GO:0000303, GO:0000302, GO:0006801, GO:0070887, GO:0044699, GO:0051716, GO:0071451, GO:0009987, GO:0034614, GO:0072593, GO:0006950, GO:0044763, GO:0008152, GO:0042221, GO:0034599, GO:0010035, GO:0006979, GO:1901700, GO:1901701, GO:0050896, GO:0044237, GO:0033554, GO:0008150
GO:0042744 [BP]	hydrogen peroxide catabolic process	probable	GO:0000302, GO:0044248, GO:0042743, GO:0070887, GO:0044699, GO:0051716, GO:0070301, GO:0009987, GO:0034614, GO:0072593, GO:0006950, GO:0008150, GO:0008152, GO:0042221, GO:0034599, GO:0010035, GO:0009056, GO:0006979, GO:1901700, GO:1901701, GO:0042542, GO:0050896, GO:0044237, GO:0033554, GO:0044763
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0043022 [MF]	ribosome binding	probable	GO:0043021, GO:0003674, GO:0005488
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0006974 [BP]	response to DNA damage stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0042594 [BP]	response to starvation	probable	GO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0006950, GO:0008150
GO:0043154 [BP]	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	probable	GO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0043086, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:0010259, GO:0006915, GO:0052547, GO:0052548, GO:0009987, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:0008150
GO:0005769 [CC]	early endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0043524 [BP]	negative regulation of neuron apoptotic process	probable	GO:0010941, GO:0060548, GO:0043066, GO:0050794, GO:0008150, GO:0043067, GO:0043523, GO:0065007, GO:0048523, GO:0048519, GO:1901214, GO:1901215, GO:0042981, GO:0050789, GO:0043069
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0051704 [BP]	multi-organism process	probable	GO:0008150
GO:0030447 [BP]	filamentous growth	probable	GO:0008150, GO:0040007, GO:0044699
GO:0009579 [CC]	thylakoid	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0048731 [BP]	system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0030985 [MF]	high molecular weight kininogen binding	probable	GO:0030984, GO:0003674, GO:0005488, GO:0005515
GO:0048046 [CC]	apoplast	probable	GO:0005575, GO:0005576
GO:0005782 [CC]	peroxisomal matrix	probable	GO:0005737, GO:0005575, GO:0043231, GO:0042579, GO:0044464, GO:0043233, GO:0005777, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0031907, GO:0044424, GO:0044439, GO:0044438, GO:0043227, GO:0043226, GO:0044422
GO:0019900 [MF]	kinase binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0002376 [BP]	immune system process	probable	GO:0008150
GO:0033673 [BP]	negative regulation of kinase activity	probable	GO:0042325, GO:0051348, GO:0019220, GO:0019222, GO:0050790, GO:0031323, GO:0051338, GO:0050789, GO:0051174, GO:0065007, GO:0043549, GO:0044092, GO:0008150, GO:0065009, GO:0050794, GO:0043086
GO:0010319 [CC]	stromule	probable	GO:0009526, GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0004602 [MF]	glutathione peroxidase activity	probable	GO:0016209, GO:0003824, GO:0003674, GO:0016684, GO:0004601, GO:0016491
GO:0007252 [BP]	I-kappaB phosphorylation	probable	GO:0016310, GO:0023052, GO:0007165, GO:0035556, GO:0050789, GO:0044699, GO:0044267, GO:0051716, GO:0044260, GO:0071704, GO:0065007, GO:0006468, GO:0044238, GO:0009987, GO:0006464, GO:0050794, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0007154, GO:0044700, GO:0007243, GO:0019538, GO:0050896, GO:0007249, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0008150
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0005844 [CC]	polysome	probable	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0008340 [BP]	determination of adult lifespan	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0005719 [CC]	nuclear euchromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0000791, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0045454 [BP]	cell redox homeostasis	probable	GO:0019725, GO:0009987, GO:0050794, GO:0042592, GO:0044763, GO:0008150, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0051092 [BP]	positive regulation of NF-kappaB transcription factor activity	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051091, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005759 [CC]	mitochondrial matrix	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.11.-.-	Acting on a peroxide as acceptor.	probable
1.11.1.-	Peroxidases.	probable
1.11.1.15	Peroxiredoxin.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QPM, chain A
Confidence level:very confident
Coverage over the Query: 60-224
View the alignment between query and template
View the model in PyMOL

Template: 3A2V, chain A
Confidence level:very confident
Coverage over the Query: 63-258
View the alignment between query and template
View the model in PyMOL

Template: 1AB8, chain A
Confidence level:confident
Coverage over the Query: 224-260
View the alignment between query and template
View the model in PyMOL