Diaphorina citri psyllid: psy16163

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MTVTNTSVTYTHKGVPYCHVPCYGALFGPQLFGHGTRVESHTSFGKVENKPCGSNMPRSHLESKLNLYNQYYDGKSGEIRSREVT
cCEECcEEEEECccccccccccccccccccccccccccEECcccccccccccccccccHHHHHHHHHHHHHccccccEEEEECcc
****N*SVTYTHKGVPYCHVPCYGALFGPQLFGHGTRV**********************LESKLNLYNQYYDG***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVTNTSVTYTHKGVPYCHVPCYGALFGPQLFGHGTRVESHTSFGKVENKPCGSNMPRSHLESKLNLYNQYYDGKSGEIRSREVT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009968 [BP]negative regulation of signal transductionprobableGO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0010332 [BP]response to gamma radiationprobableGO:0008150, GO:0009314, GO:0050896, GO:0010212, GO:0009628
GO:0040014 [BP]regulation of multicellular organism growthprobableGO:0008150, GO:0040008, GO:0065007, GO:0050789, GO:0051239

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IML, chain A
Confidence level:confident
Coverage over the Query: 2-43
View the alignment between query and template
View the model in PyMOL