Diaphorina citri psyllid: psy16169


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MNVVPKGICLRLCSSSSSASTKYDVDLLKSDVALARDRVSRLKRELEQIRTEMNYTQRGLVPMGTRLAEMARMRLEYDETRKRIQIIQTQLADLEEKVTPGQAESDKDRLILFQEKEQLLRSRSMSLIRWPIKDTIVPI
ccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccccccc
*****KGICLRLCSS*******YDVDLLKSDVALARDRV******LEQIRTEMNYTQRGLVPMGTRLAEMARMRLEYDETRKRIQIIQTQLADLEEKVTPGQAESDKDRLILFQEKEQLL***SMSLIRWPIKDT*VPI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVVPKGICLRLCSSSSSASTKYDxxxxxxxxxxxxxxxxxxxxxxxxxxxxMNYTQRGLVPMGTRLAExxxxxxxxxxxxxxxxxxxxxxxxxxxxVTPGQAESDKDRLILFQEKEQLLRSRSMSLIRWPIKDTIVPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein kibra Regulator of the Hippo/SWH (Sav/Wts/Hpo) signaling pathway, a signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein Hippo (Hpo), in complex with its regulatory protein Salvador (Sav), phosphorylates and activates Warts (Wts) in complex with its regulatory protein Mats, which in turn phosphorylates and inactivates the Yorkie (Yki) oncoprotein. Kibra acts synergistically along with Ex and Mer to regulate the Hippo signaling pathway.confidentQ9VFG8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F1M, chain A
Confidence level:probable
Coverage over the Query: 22-67
View the alignment between query and template
View the model in PyMOL