Diaphorina citri psyllid: psy16172


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MNIYSFDLGLIGPLRAQYLALTYAMNHADMGNPDREPCPYSGSPNFARQGGITNGAKWYVVTGGMQDFNYLSSNDFELTLELGCVKFPPAELLPNEWERNKNALVEFMWKVSKSLWATSIGGKRLPLWPRGQEQ
cccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEccccccccccEEEECcCEEEEEEEEccccccccccHHHHHHcHHHHHHHHHHHHcccEEEEEcccccccccccccc
MNIYSFDLGLIGPLRAQYLALTYAMNHADMGNPDREPCPYSGSPNFARQGGITNGAKWYVVTGGMQDFNYLSSNDFELTLELGCVKFPPAELLPNEWERNKNALVEFMWKVSKSLWATSIGGKRLPLW******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIYSFDLGLIGPLRAQYLALTYAMNHADMGNPDREPCPYSGSPNFARQGGITNGAKWYVVTGGMQDFNYLSSNDFELTLELGCVKFPPAELLPNEWERNKNALVEFMWKVSKSLWATSIGGKRLPLWPRGQEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0051384 [BP]response to glucocorticoid stimulusprobableGO:0009719, GO:0033993, GO:0031960, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0004180 [MF]carboxypeptidase activityprobableGO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MN8, chain A
Confidence level:very confident
Coverage over the Query: 1-127
View the alignment between query and template
View the model in PyMOL