Diaphorina citri psyllid: psy16174

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------

LHDQTVSEVLSSRKRRQGRNQPFRERTLSVQNNIRPGRESNPGPSADKEGKETMRLPKLTALPDVTLRKLSTDWEFLVIACDGIWDVMTNEEVSDFVRMRIGSGMEPEEICEDLMTRCLAPDCQMGGLGCDNMTVVIVCFLHGNPYSSLVNKCALLQ

cccccccEEEccccccccccHHHHHHHHHcccEEEcccccccccHcccccccccccccCCccccEEEEEcccccEEEEEEEcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccEEEEEEEccccccHHHHHHHHHcc

******S*******************TLSVQNNIRPGRESNPGPSADKEGKETMRLPKLTALPDVTLRKLSTDWEFLVIACDGIWDVMTNEEVSDFVRMRIGSGMEPEEICEDLMTRCLAPDCQMGGLGCDNMTVVIVCFLHGNPYSSLVNKCAL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

LHDQTVSEVLSSRKRRQGRNQPFRERTLSVQNNIRPGRESNPGPSADKEGKETMRLPKLTALPDVTLRKLSTDWEFLVIACDGIWDVMTNEEVSDFVRMRIGSGMEPEEICEDLMTRCLAPDCQMGGLGCDNMTVVIVCFLHGNPYSSLVNKCALLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable protein phosphatase 2C T23F11.1		confident	P49596

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006470 [BP]	protein dephosphorylation	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004722 [MF]	protein serine/threonine phosphatase activity	probable	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I0O, chain A
Confidence level:very confident
Coverage over the Query: 3-119,132-141
View the alignment between query and template
View the model in PyMOL