Diaphorina citri psyllid: psy16185

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---

MLCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQDLPQAAEVRHAEETTSVGLRGPATQYVADLVKLGTPCIKRETST

cEEEEEcccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccHHcccccccEECcHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHcccHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccc

*LCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQD*****************LRGPATQYVADLVKLGTPCIK*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0051865 [BP]	protein autoubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0000209 [BP]	protein polyubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005741 [CC]	mitochondrial outer membrane	probable	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0090140 [BP]	regulation of mitochondrial fission	probable	GO:0033043, GO:0050793, GO:0022603, GO:0051128, GO:0008150, GO:0010821, GO:0065007, GO:0050794, GO:0050789

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D8S, chain A
Confidence level:confident
Coverage over the Query: 7-76
View the alignment between query and template
View the model in PyMOL