Psyllid ID: psy16185

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MLCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQDLPQAAEVRHAEETTSVGLRGPATQYVADLVKLGTPCIKRETST
cEEEEEcccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccHHcccccccEEEHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHcccHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEEEEcccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccEccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccEEEEcccHHHHHHHHHHccHHHHHHHHHHHcccccccccccccHHHccccEEEEEcccHHHHEEHEHHHHHHcccccccccccHHHEHcccccccccccccHHHHHHHHHHcccccccccccc
MLCLVIISSDLKYCWVCFatheddrnalwvqpclcrgtskwVHQACLNRWIdekqkgnaftqvacpqcntkyfivypyRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLvhplvninrqYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWChihrhqghpqdlpqaaevrhaeettsvglrgpatQYVADLVKLgtpcikretst
MLCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRArqvigrenglqvmREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQDLPQAAEVRHAEEttsvglrgpatqYVADLVKLgtpcikretst
MLCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQDLPQAAEVRHAEETTSVGLRGPATQYVADLVKLGTPCIKRETST
*LCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRH***********************LRGPATQYVADLVKLGTPCI******
*******SSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQK*****QVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQD***********************QYVADLVKLGTPCIK*****
MLCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQDLPQAAEVRHAEETTSVGLRGPATQYVADLVKLGTPCIKRETST
MLCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQDLPQAAEVRH*E*TTSVGLRGPATQYVADLVKLGTPCIK*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLCLVIISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWCHIHRHQGHPQDLPQAAEVRHAEETTSVGLRGPATQYVADLVKLGTPCIKRETST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query263 2.2.26 [Sep-21-2011]
Q6GM44283 E3 ubiquitin-protein liga N/A N/A 0.551 0.512 0.474 1e-46
Q3KNM2278 E3 ubiquitin-protein liga yes N/A 0.551 0.521 0.469 3e-46
Q9NX47278 E3 ubiquitin-protein liga yes N/A 0.551 0.521 0.469 3e-46
Q0X0A5278 E3 ubiquitin-protein liga N/A N/A 0.551 0.521 0.469 3e-46
Q3ZC24278 E3 ubiquitin-protein liga yes N/A 0.551 0.521 0.469 3e-46
Q5ZJ41281 E3 ubiquitin-protein liga yes N/A 0.551 0.516 0.464 8e-46
Q6NYK8289 E3 ubiquitin-protein liga no N/A 0.551 0.501 0.438 1e-42
Q5R9W1 910 E3 ubiquitin-protein liga yes N/A 0.349 0.101 0.292 0.0006
O60337 910 E3 ubiquitin-protein liga no N/A 0.349 0.101 0.292 0.0006
Q6ZQ89 909 E3 ubiquitin-protein liga no N/A 0.349 0.101 0.292 0.0007
>sp|Q6GM44|MARH5_XENLA E3 ubiquitin-protein ligase MARCH5 OS=Xenopus laevis GN=march5 PE=2 SV=1 Back     alignment and function desciption
 Score =  186 bits (473), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 114/196 (58%), Gaps = 51/196 (26%)

Query: 12  KYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTK 71
           + CWVCFAT EDDR A WV+PC CRG++KWVHQACL RW+DEKQ+GN+  +VACPQCN +
Sbjct: 15  RSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAE 74

Query: 72  YFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYL 131
           Y IV+P  G +V +LD  D  + K CPF AAG+++GS+YW AVTYGAVTVM         
Sbjct: 75  YLIVFPNLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVM--------- 125

Query: 132 GALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMREVDAI 191
                                                     QV+G + GL VM   D +
Sbjct: 126 ------------------------------------------QVVGHKEGLDVMERADPL 143

Query: 192 VLLLGLPAIPVVLILG 207
            LL+GLP IPVVLILG
Sbjct: 144 FLLIGLPTIPVVLILG 159
Mitochondrial E3 ubiquitin-protein ligase that plays a crucial role in the control of mitochondrial morphology by acting as a positive regulator of mitochondrial fission. May play a role in the prevention of cell senescence acting as a regulator of mitochondrial quality control.
Xenopus laevis (taxid: 8355)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q3KNM2|MARH5_MOUSE E3 ubiquitin-protein ligase MARCH5 OS=Mus musculus GN=March5 PE=2 SV=1 Back     alignment and function description
>sp|Q9NX47|MARH5_HUMAN E3 ubiquitin-protein ligase MARCH5 OS=Homo sapiens GN=MARCH5 PE=1 SV=1 Back     alignment and function description
>sp|Q0X0A5|MARH5_CHLAE E3 ubiquitin-protein ligase MARCH5 OS=Chlorocebus aethiops GN=MARCH5 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZC24|MARH5_BOVIN E3 ubiquitin-protein ligase MARCH5 OS=Bos taurus GN=MARCH5 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJ41|MARH5_CHICK E3 ubiquitin-protein ligase MARCH5 OS=Gallus gallus GN=MARCH5 PE=2 SV=1 Back     alignment and function description
>sp|Q6NYK8|MARH5_DANRE E3 ubiquitin-protein ligase MARCH5 OS=Danio rerio GN=march5 PE=2 SV=1 Back     alignment and function description
>sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 Back     alignment and function description
>sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 Back     alignment and function description
>sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
307195732 397 E3 ubiquitin-protein ligase MARCH5 [Harp 0.570 0.377 0.482 2e-50
332018806 425 E3 ubiquitin-protein ligase MARCH5 [Acro 0.558 0.345 0.489 4e-50
307181190 400 E3 ubiquitin-protein ligase MARCH5 [Camp 0.566 0.372 0.48 1e-49
340728879 398 PREDICTED: e3 ubiquitin-protein ligase M 0.566 0.374 0.48 5e-49
350420201 398 PREDICTED: E3 ubiquitin-protein ligase M 0.558 0.369 0.484 5e-49
291240453337 PREDICTED: membrane-associated ring fing 0.551 0.430 0.5 5e-49
340728875 398 PREDICTED: e3 ubiquitin-protein ligase M 0.566 0.374 0.48 5e-49
156554697 381 PREDICTED: E3 ubiquitin-protein ligase M 0.566 0.391 0.485 2e-48
380011359 397 PREDICTED: E3 ubiquitin-protein ligase M 0.566 0.375 0.47 5e-48
328792901 397 PREDICTED: e3 ubiquitin-protein ligase M 0.566 0.375 0.47 5e-48
>gi|307195732|gb|EFN77572.1| E3 ubiquitin-protein ligase MARCH5 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 124/201 (61%), Gaps = 51/201 (25%)

Query: 7   ISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACP 66
           +  D +YCWVCFAT EDD  A WV+PC CRGT+KWVHQ C+ RW+DEKQKG+A   VACP
Sbjct: 111 MDEDKRYCWVCFATDEDDATAAWVKPCHCRGTTKWVHQGCIQRWVDEKQKGHAEHAVACP 170

Query: 67  QCNTKYFIVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSP 126
           QCNT+Y IVYP  G LV +LDTIDT ++++CPF+AAG+V+GS+YW AVTYGAVTVM    
Sbjct: 171 QCNTEYIIVYPNMGPLVVILDTIDTVIFRVCPFIAAGIVVGSIYWTAVTYGAVTVM---- 226

Query: 127 LHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLLRRLRARQVIGRENGLQVMR 186
                                                          QV+G ++GL +M 
Sbjct: 227 -----------------------------------------------QVVGHKDGLTMME 239

Query: 187 EVDAIVLLLGLPAIPVVLILG 207
           + D +VLL+GLP IP++L+LG
Sbjct: 240 QADPLVLLVGLPTIPIMLVLG 260

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332018806|gb|EGI59365.1| E3 ubiquitin-protein ligase MARCH5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307181190|gb|EFN68890.1| E3 ubiquitin-protein ligase MARCH5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340728879|ref|XP_003402740.1| PREDICTED: e3 ubiquitin-protein ligase MARCH5-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350420201|ref|XP_003492432.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like isoform 1 [Bombus impatiens] gi|350420204|ref|XP_003492433.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|291240453|ref|XP_002740133.1| PREDICTED: membrane-associated ring finger (C3HC4) 5-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|340728875|ref|XP_003402738.1| PREDICTED: e3 ubiquitin-protein ligase MARCH5-like isoform 1 [Bombus terrestris] gi|340728877|ref|XP_003402739.1| PREDICTED: e3 ubiquitin-protein ligase MARCH5-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|156554697|ref|XP_001606276.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like isoform 1 [Nasonia vitripennis] gi|345494225|ref|XP_003427252.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380011359|ref|XP_003689775.1| PREDICTED: E3 ubiquitin-protein ligase MARCH5-like [Apis florea] Back     alignment and taxonomy information
>gi|328792901|ref|XP_624445.3| PREDICTED: e3 ubiquitin-protein ligase MARCH5-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
UNIPROTKB|Q6GM44283 march5 "E3 ubiquitin-protein l 0.422 0.392 0.657 1.4e-50
UNIPROTKB|F1MBH0267 MARCH5 "E3 ubiquitin-protein l 0.422 0.415 0.657 2.9e-50
UNIPROTKB|Q3ZC24278 MARCH5 "E3 ubiquitin-protein l 0.422 0.399 0.657 2.9e-50
UNIPROTKB|E2RIR8278 MARCH5 "Uncharacterized protei 0.422 0.399 0.657 2.9e-50
UNIPROTKB|Q9NX47278 MARCH5 "E3 ubiquitin-protein l 0.422 0.399 0.657 2.9e-50
UNIPROTKB|F2Z5H0278 MARCH5 "Uncharacterized protei 0.422 0.399 0.657 2.9e-50
UNIPROTKB|Q0X0A5278 MARCH5 "E3 ubiquitin-protein l 0.422 0.399 0.657 2.9e-50
MGI|MGI:1915207278 March5 "membrane-associated ri 0.422 0.399 0.657 2.9e-50
RGD|1305617278 March5 "membrane-associated ri 0.422 0.399 0.657 2.9e-50
ZFIN|ZDB-GENE-070424-47281 march5 "membrane-associated ri 0.422 0.395 0.648 6e-50
UNIPROTKB|Q6GM44 march5 "E3 ubiquitin-protein ligase MARCH5" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 435 (158.2 bits), Expect = 1.4e-50, Sum P(2) = 1.4e-50
 Identities = 73/111 (65%), Positives = 89/111 (80%)

Query:    14 CWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYF 73
             CWVCFAT EDDR A WV+PC CRG++KWVHQACL RW+DEKQ+GN+  +VACPQCN +Y 
Sbjct:    17 CWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYL 76

Query:    74 IVYPYRGLLVSLLDTIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVV 124
             IV+P  G +V +LD  D  + K CPF AAG+++GS+YW AVTYGAVTVM V
Sbjct:    77 IVFPNLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQV 127
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005741 "mitochondrial outer membrane" evidence=ISS
GO:0005783 "endoplasmic reticulum" evidence=ISS
GO:0051865 "protein autoubiquitination" evidence=ISS
GO:0090140 "regulation of mitochondrial fission" evidence=ISS
GO:0090344 "negative regulation of cell aging" evidence=ISS
UNIPROTKB|F1MBH0 MARCH5 "E3 ubiquitin-protein ligase MARCH5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZC24 MARCH5 "E3 ubiquitin-protein ligase MARCH5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIR8 MARCH5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NX47 MARCH5 "E3 ubiquitin-protein ligase MARCH5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5H0 MARCH5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0X0A5 MARCH5 "E3 ubiquitin-protein ligase MARCH5" [Chlorocebus aethiops (taxid:9534)] Back     alignment and assigned GO terms
MGI|MGI:1915207 March5 "membrane-associated ring finger (C3HC4) 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305617 March5 "membrane-associated ring finger (C3HC4) 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-47 march5 "membrane-associated ring finger (C3HC4) 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 7e-13
pfam1290647 pfam12906, RINGv, RING-variant domain 3e-10
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 1e-04
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 0.001
PHA02862156 PHA02862, PHA02862, 5L protein; Provisional 0.001
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 61.2 bits (149), Expect = 7e-13
 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 8/57 (14%)

Query: 13 YCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCN 69
           C +C    E D     V PC C+G+ K+VHQ CL RWI+E           C  C 
Sbjct: 1  ICRICHD--EGDEGDPLVSPCRCKGSLKYVHQECLERWINESGN------KTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|165197 PHA02862, PHA02862, 5L protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 263
KOG3053|consensus293 100.0
PHA02862156 5L protein; Provisional 99.75
PHA02825162 LAP/PHD finger-like protein; Provisional 99.73
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.69
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.66
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.64
KOG1609|consensus323 99.0
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.84
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.22
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.6
PHA02929238 N1R/p28-like protein; Provisional 96.54
KOG4628|consensus348 95.9
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 95.69
PHA02926242 zinc finger-like protein; Provisional 95.64
cd0016245 RING RING-finger (Really Interesting New Gene) dom 95.63
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 95.6
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 95.18
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 94.98
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 94.55
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 94.12
KOG0823|consensus230 92.97
KOG1493|consensus84 91.2
PLN02189 1040 cellulose synthase 90.8
COG52191525 Uncharacterized conserved protein, contains RING Z 90.75
KOG1645|consensus 463 90.48
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 90.4
KOG0802|consensus543 90.23
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 89.07
smart0050463 Ubox Modified RING finger domain. Modified RING fi 88.45
KOG0828|consensus636 87.92
PLN02436 1094 cellulose synthase A 87.61
PLN02195 977 cellulose synthase A 86.07
PF1463444 zf-RING_5: zinc-RING finger domain 85.33
KOG1734|consensus328 84.49
KOG0317|consensus293 82.88
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 82.19
PF10272358 Tmpp129: Putative transmembrane protein precursor; 81.48
KOG0804|consensus493 81.29
KOG0827|consensus 465 80.61
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 80.46
>KOG3053|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.5e-50  Score=363.82  Aligned_cols=151  Identities=58%  Similarity=1.195  Sum_probs=147.3

Q ss_pred             cCCCCeeeEecccCcCCCCCcceeccCCCCCCccccHHHHHHHHHHhccCCCCCCcccccCCcceeeccCCcchHHHHHH
Q psy16185          8 SSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIVYPYRGLLVSLLD   87 (263)
Q Consensus         8 ~ee~~~CrIC~~~eeed~~~~~v~PC~C~GS~k~VHq~CL~rWI~esq~~n~~~~~~CeqCk~eY~i~~P~~~~l~~lle   87 (263)
                      .+.++.|||||++++|++...|++||+|+||+|||||+||.+|++||+.+|+.+.+.|+||++||.|++|+++++...+|
T Consensus        17 ~e~eR~CWiCF~TdeDn~~a~WV~PCrCRGt~KWVHqsCL~rWiDEK~~~n~~q~V~C~QCqTEYiiv~P~l~~~~~~Le   96 (293)
T KOG3053|consen   17 QELERCCWICFATDEDNRLAAWVHPCRCRGTTKWVHQSCLSRWIDEKQRGNPLQTVSCPQCQTEYIIVFPQLGPFDRVLE   96 (293)
T ss_pred             cccceeEEEEeccCcccchhhhcccccccCccHHHHHHHHHHHHhHHhcCCCCceeechhhcchheeeccccChHHHHHH
Confidence            45689999999999999888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhhhhhhHHHHHHhHHhHhHhhhhhhhHhhhccccccccccchhhhccccccccchhhhhhhhhhhhhhhhhhH
Q psy16185         88 TIDTAVYKLCPFVAAGVVLGSMYWCAVTYGAVTVMVVSPLHTYLGALSLRFCLVHPLVNINRQYRFQLDNILRICDKGLL  167 (263)
Q Consensus        88 ~vdr~~~~l~pfla~gil~g~vyW~a~tyGa~Tv~~~~~~~a~~g~~~~r~~s~~~~v~lp~~~~~~~~ni~~d~~~g~~  167 (263)
                      .+|....++|||+++|++++++||+|++|||.|++                                             
T Consensus        97 ~~d~~i~r~cp~l~~g~~v~~iYWsAVtyGA~T~l---------------------------------------------  131 (293)
T KOG3053|consen   97 RLDILIFRLCPFLAAGIFVGSIYWSAVTYGAVTVL---------------------------------------------  131 (293)
T ss_pred             HhhhHHhhcChHHHHHHHhheeehhhhhhcceeee---------------------------------------------
Confidence            99999999999999999999999999999999999                                             


Q ss_pred             hhhhhceeccchhhhhhhhhhhhHHHHhcCChhhHHHHHhhh
Q psy16185        168 RRLRARQVIGRENGLQVMREVDAIVLLLGLPAIPVVLILGWC  209 (263)
Q Consensus       168 ~~~~~~~v~g~~~~~~~m~~~~~~~~~~glp~ip~~lil~r~  209 (263)
                            ||.|++.|+++|++.||.++++|||+|||+|||||+
T Consensus       132 ------Qv~G~~~~m~ime~~d~~~lliGlP~ipv~LiL~Rl  167 (293)
T KOG3053|consen  132 ------QVVGQEHGMQIMESGDPLFLLIGLPSIPVGLILGRL  167 (293)
T ss_pred             ------ehhhhHHHHHHHhcCCceEEEEcCCcchHHHHHhhh
Confidence                  999999999999999999999999999999999996

>PHA02862 5L protein; Provisional Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1609|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 4e-17
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 1e-13
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 7e-04
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 73.0 bits (179), Expect = 4e-17
 Identities = 20/75 (26%), Positives = 30/75 (40%), Gaps = 8/75 (10%)

Query: 6  IISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVAC 65
          I  S    C +C    +D+     + PC C G+  +VHQACL +WI             C
Sbjct: 10 ITPSSQDICRICHCEGDDESP--LITPCHCTGSLHFVHQACLQQWIKSSDT------RCC 61

Query: 66 PQCNTKYFIVYPYRG 80
            C  ++ +     G
Sbjct: 62 ELCKYEFIMETKLSG 76
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.75
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.63
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.76
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.76
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.69
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.68
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.44
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.4
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.39
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.36
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.24
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.22
2ect_A78 Ring finger protein 126; metal binding protein, st 97.12
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.12
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.03
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 96.93
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 96.85
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.82
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.79
2ecw_A85 Tripartite motif-containing protein 30; metal bind 96.68
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 96.53
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 96.52
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 96.5
2ysl_A73 Tripartite motif-containing protein 31; ring-type 96.5
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.47
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.37
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 96.35
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 96.27
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.26
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.19
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 96.18
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 96.14
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 96.06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 96.03
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 95.86
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.84
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 95.55
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 95.55
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 95.42
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.31
1z6u_A150 NP95-like ring finger protein isoform B; structura 95.24
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 95.22
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.16
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 95.11
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 95.01
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 94.56
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 94.53
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 94.5
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 94.17
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 93.61
3nw0_A238 Non-structural maintenance of chromosomes element 92.59
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 92.42
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 90.76
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 90.35
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 90.26
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 90.04
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 88.49
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 88.33
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 87.62
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 87.25
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 86.74
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 85.7
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 85.4
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 84.49
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 83.89
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 82.22
1wil_A89 KIAA1045 protein; ring finger domain, structural g 81.52
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.75  E-value=4.1e-19  Score=128.45  Aligned_cols=58  Identities=28%  Similarity=0.723  Sum_probs=51.4

Q ss_pred             ecCCCCeeeEecccCcCCCCCcceeccCCCCCCccccHHHHHHHHHHhccCCCCCCcccccCCcceee
Q psy16185          7 ISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFI   74 (263)
Q Consensus         7 ~~ee~~~CrIC~~~eeed~~~~~v~PC~C~GS~k~VHq~CL~rWI~esq~~n~~~~~~CeqCk~eY~i   74 (263)
                      .+++++.||||+++++    ++|++||+|+||++|||++||++|+++++      +..||+|+++|.+
T Consensus         2 e~~~~~~CrIC~~~~~----~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~------~~~C~~C~~~~~~   59 (60)
T 1vyx_A            2 EDEDVPVCWICNEELG----NERFRACGCTGELENVHRSCLSTWLTISR------NTACQICGVVYNT   59 (60)
T ss_dssp             TTCSCCEETTTTEECS----CCCCCSCCCSSGGGSCCHHHHHHHHHHHT------CSBCTTTCCBCCC
T ss_pred             CCCCCCEeEEeecCCC----CceecCcCCCCchhhhHHHHHHHHHHhCC------CCccCCCCCeeec
Confidence            4567899999998743    36899999999999999999999999886      6899999999986
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 263
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-05
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 0.001
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.003
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 39.1 bits (90), Expect = 2e-05
 Identities = 16/65 (24%), Positives = 26/65 (40%), Gaps = 10/65 (15%)

Query: 10 DLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCN 69
          D+  CW+C     ++      + C C G  + VH++CL+ W+            AC  C 
Sbjct: 5  DVPVCWICN----EELGNERFRACGCTGELENVHRSCLSTWLTI------SRNTACQICG 54

Query: 70 TKYFI 74
            Y  
Sbjct: 55 VVYNT 59
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.53
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.89
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.88
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.73
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.47
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.44
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.25
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 96.89
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.38
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.69
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 95.53
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 94.95
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 93.26
d2c2la280 STIP1 homology and U box-containing protein 1, STU 92.99
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 90.65
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 90.63
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 90.1
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 87.21
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.53  E-value=1.5e-15  Score=106.87  Aligned_cols=59  Identities=27%  Similarity=0.699  Sum_probs=51.7

Q ss_pred             ecCCCCeeeEecccCcCCCCCcceeccCCCCCCccccHHHHHHHHHHhccCCCCCCcccccCCcceeec
Q psy16185          7 ISSDLKYCWVCFATHEDDRNALWVQPCLCRGTSKWVHQACLNRWIDEKQKGNAFTQVACPQCNTKYFIV   75 (263)
Q Consensus         7 ~~ee~~~CrIC~~~eeed~~~~~v~PC~C~GS~k~VHq~CL~rWI~esq~~n~~~~~~CeqCk~eY~i~   75 (263)
                      .+++...|+||+++.+    ++.+.||.|+|+.+++|++||.+|+.+++      +..||+|+++|++.
T Consensus         2 eded~~~C~IC~~~~~----~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~------~~~CP~Cr~~~~~k   60 (60)
T d1vyxa_           2 EDEDVPVCWICNEELG----NERFRACGCTGELENVHRSCLSTWLTISR------NTACQICGVVYNTR   60 (60)
T ss_dssp             TTCSCCEETTTTEECS----CCCCCSCCCSSGGGSCCHHHHHHHHHHHT------CSBCTTTCCBCCCC
T ss_pred             CCCCCCCCccCCccCC----CceeEecccCCCCCEEcHHHHHHHHhhCC------CCCCcccCCeeecC
Confidence            4678899999998754    35789999999999999999999999876      57899999999863
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure