Diaphorina citri psyllid: psy1618


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MAAKLVLEEETFLEHEYEGEEEERSEAESVKLDGDEVPAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL
ccccccccHHHHHccccccccccHHHHHHHcccccccccccccccccccHHEEEEcccccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHccccccccHHHHHHHccccEEEEEEccccHHHHHHHHHcccccHHHHccccccHHccccccccccccccHHHHHHHHHccc
*********ETFLEHEYEGEEEERS************PAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKLVLEEETFLEHEYEGEEEERSEAESVKLDGDEVPAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleoside diphosphate kinase 6 (Fragment) Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.confidentO88426
Nucleoside diphosphate kinase Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.confidentQ0I2G6
Nucleoside diphosphate kinase Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.confidentO67528

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004550 [MF]nucleoside diphosphate kinase activityprobableGO:0019205, GO:0016772, GO:0016301, GO:0016776, GO:0003824, GO:0016740, GO:0003674
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045839 [BP]negative regulation of mitosisprobableGO:0051128, GO:0007346, GO:0009987, GO:0045786, GO:0051726, GO:0008150, GO:0033043, GO:0010564, GO:0010639, GO:0051129, GO:0050794, GO:0051783, GO:0010948, GO:0065007, GO:0044763, GO:0044699, GO:0051784, GO:0048519, GO:0007088, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W7W, chain A
Confidence level:very confident
Coverage over the Query: 46-178
View the alignment between query and template
View the model in PyMOL