Psyllid ID: psy1618

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MAAKLVLEEETFLEHEYEGEEEERSEAESVKLDGDEVPAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL
ccccccccHHHHHccccccccccHHHHHHHcccccccccccccccccccHHEEEEcccccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHccccccHHHHHHHHccccEEEEEEccccHHHHHHHHHccccHHHHHHcccccHHccccccccccccccHHHHHHHHHccc
ccHHHEHHHcccHHHcEEcccEEEEEEEEEEEccccccHHHcccHHHHccEEEEEcccHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHccccccccccHHHEEccccEEEEEEEcccHHHHHHHHHcccccHHHHccccccEEccEEEEccccccccHHHHHHHHcccc
MAAKLVLEEEtfleheyegeeeerseaesvkldgdevpapivqnlhCYEYTLAlvkphafrhvEDIEQTIQEKGFTIVKkktfkftpeQAAEFFITreerdpvkvprLVCYMVSGPVRVMVLAKQKAIRRWLHlmgpvdpdkakriyplslrakygvndimnGSWVLQILTKQKEFTL
maaklvleeetfleheyegeeeerseAESVKLDGDEVPAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEffitreerdpvkvpRLVCYMVSGPVRVMVLAKQKAIRRWlhlmgpvdpdkakrIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL
MAAKLVLeeetfleheyegeeeerseaeSVKLDGDEVPAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEkgftivkkktfkftPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL
*************************************PAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILT*******
*********ETFLEHEYEGEEEERS*****************QNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL
MAAKLVLEEETFL******************LDGDEVPAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL
*AAKLVLEEETFLEHEYEGEEEERSEAESVKLDGDEVPAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNG*********Q***TL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKLVLEEETFLEHEYEGEEEERSEAESVKLDGDEVPAPIVQNLHCYEYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQILTKQKEFTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
P56597212 Nucleoside diphosphate ki yes N/A 0.634 0.533 0.417 9e-20
Q99MH5211 Nucleoside diphosphate ki yes N/A 0.634 0.535 0.4 3e-18
P90666 837 Thioredoxin domain-contai N/A N/A 0.707 0.150 0.360 9e-15
Q8N427588 Thioredoxin domain-contai no N/A 0.668 0.202 0.352 3e-14
Q715T0586 Thioredoxin domain-contai no N/A 0.617 0.187 0.4 9e-14
Q715S9587 Thioredoxin domain-contai no N/A 0.617 0.187 0.373 1e-13
O75414186 Nucleoside diphosphate ki no N/A 0.685 0.655 0.346 1e-13
O88426175 Nucleoside diphosphate ki yes N/A 0.629 0.64 0.376 1e-13
O67528142 Nucleoside diphosphate ki yes N/A 0.623 0.781 0.393 2e-13
O88425189 Nucleoside diphosphate ki no N/A 0.674 0.634 0.352 3e-13
>sp|P56597|NDK5_HUMAN Nucleoside diphosphate kinase homolog 5 OS=Homo sapiens GN=NME5 PE=2 SV=1 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 70/115 (60%), Gaps = 2/115 (1%)

Query: 49  EYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRL 108
           E TLA++KP      E+I+  I   GFTIV+++  + +PEQ + F++  E+   +  P L
Sbjct: 13  EKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYV--EKYGKMFFPNL 70

Query: 109 VCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNG 163
             YM SGP+  M+LA+ KAI  WL L+GP +   AK  +P SLRA YG +D+ N 
Sbjct: 71  TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNA 125
Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species.
Homo sapiens (taxid: 9606)
>sp|Q99MH5|NDK5_MOUSE Nucleoside diphosphate kinase homolog 5 OS=Mus musculus GN=Nme5 PE=2 SV=2 Back     alignment and function description
>sp|P90666|TXND3_HELCR Thioredoxin domain-containing protein 3 homolog OS=Heliocidaris crassispina GN=NME8 PE=1 SV=1 Back     alignment and function description
>sp|Q8N427|TXND3_HUMAN Thioredoxin domain-containing protein 3 OS=Homo sapiens GN=NME8 PE=1 SV=2 Back     alignment and function description
>sp|Q715T0|TXND3_MOUSE Thioredoxin domain-containing protein 3 OS=Mus musculus GN=Nme8 PE=2 SV=1 Back     alignment and function description
>sp|Q715S9|TXND3_RAT Thioredoxin domain-containing protein 3 OS=Rattus norvegicus GN=Nme8 PE=2 SV=2 Back     alignment and function description
>sp|O75414|NDK6_HUMAN Nucleoside diphosphate kinase 6 OS=Homo sapiens GN=NME6 PE=1 SV=3 Back     alignment and function description
>sp|O88426|NDK6_RAT Nucleoside diphosphate kinase 6 (Fragment) OS=Rattus norvegicus GN=Nme6 PE=2 SV=1 Back     alignment and function description
>sp|O67528|NDK_AQUAE Nucleoside diphosphate kinase OS=Aquifex aeolicus (strain VF5) GN=ndk PE=1 SV=1 Back     alignment and function description
>sp|O88425|NDK6_MOUSE Nucleoside diphosphate kinase 6 OS=Mus musculus GN=Nme6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
395504589218 PREDICTED: nucleoside diphosphate kinase 0.634 0.518 0.452 9e-21
443731813217 hypothetical protein CAPTEDRAFT_177417 [ 0.634 0.520 0.460 2e-20
225707538190 Nucleoside diphosphate kinase homolog 5 0.634 0.594 0.434 2e-20
126290644217 PREDICTED: nucleoside diphosphate kinase 0.679 0.557 0.418 1e-19
333601013146 non-metastatic cell 5 [Placozoa sp. H4] 0.640 0.780 0.396 2e-19
260803201207 hypothetical protein BRAFLDRAFT_61845 [B 0.634 0.545 0.460 4e-19
76155586203 SJCHGC08719 protein [Schistosoma japonic 0.662 0.581 0.411 5e-19
226479286208 nucleoside-diphosphate kinase [Schistoso 0.662 0.567 0.411 5e-19
72077139217 PREDICTED: nucleoside diphosphate kinase 0.634 0.520 0.434 6e-19
209735268217 Nucleoside diphosphate kinase homolog 5 0.634 0.520 0.408 6e-19
>gi|395504589|ref|XP_003756630.1| PREDICTED: nucleoside diphosphate kinase homolog 5 [Sarcophilus harrisii] Back     alignment and taxonomy information
 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 72/115 (62%), Gaps = 2/115 (1%)

Query: 49  EYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRL 108
           E TLAL+KP      E+IE  I + GFTIV+++  +F+PEQ + F++  E+   +  P L
Sbjct: 13  ERTLALIKPDIVDKEEEIEDIILKSGFTIVQRRKLRFSPEQCSNFYV--EQYGKMFFPNL 70

Query: 109 VCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNG 163
             YM SGP+  M+LA+  AI  WL LMGP +  KAK  +P SLRA YG +D+ N 
Sbjct: 71  TAYMSSGPLVAMILARHNAISYWLDLMGPFNSFKAKETHPDSLRAIYGTDDLRNA 125

Source: Sarcophilus harrisii

Species: Sarcophilus harrisii

Genus: Sarcophilus

Family: Dasyuridae

Order: Dasyuromorphia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|443731813|gb|ELU16784.1| hypothetical protein CAPTEDRAFT_177417 [Capitella teleta] Back     alignment and taxonomy information
>gi|225707538|gb|ACO09615.1| Nucleoside diphosphate kinase homolog 5 [Osmerus mordax] Back     alignment and taxonomy information
>gi|126290644|ref|XP_001375993.1| PREDICTED: nucleoside diphosphate kinase homolog 5-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|333601013|gb|AEF58837.1| non-metastatic cell 5 [Placozoa sp. H4] Back     alignment and taxonomy information
>gi|260803201|ref|XP_002596479.1| hypothetical protein BRAFLDRAFT_61845 [Branchiostoma floridae] gi|229281736|gb|EEN52491.1| hypothetical protein BRAFLDRAFT_61845 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|76155586|gb|AAX26877.2| SJCHGC08719 protein [Schistosoma japonicum] Back     alignment and taxonomy information
>gi|226479286|emb|CAX73138.1| nucleoside-diphosphate kinase [Schistosoma japonicum] Back     alignment and taxonomy information
>gi|72077139|ref|XP_790390.1| PREDICTED: nucleoside diphosphate kinase homolog 5-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|209735268|gb|ACI68503.1| Nucleoside diphosphate kinase homolog 5 [Salmo salar] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
UNIPROTKB|P56597212 NME5 "Nucleoside diphosphate k 0.629 0.528 0.377 6.9e-15
ZFIN|ZDB-GENE-040718-221217 nme5 "non-metastatic cells 5, 0.629 0.516 0.359 8.8e-15
UNIPROTKB|E1C8A0210 NME5 "Uncharacterized protein" 0.634 0.538 0.365 1.8e-14
MGI|MGI:1922783211 Nme5 "NME/NM23 family member 5 0.691 0.582 0.362 2.3e-14
UNIPROTKB|E2RLI0211 BRD8 "Uncharacterized protein" 0.629 0.530 0.359 4.9e-14
UNIPROTKB|I3LN92212 NME5 "Uncharacterized protein" 0.629 0.528 0.359 1.6e-13
UNIPROTKB|E1BDQ6209 NME5 "Uncharacterized protein" 0.629 0.535 0.342 7.1e-13
TAIR|locus:2018832181 AT1G17410 [Arabidopsis thalian 0.629 0.618 0.370 7.1e-13
UNIPROTKB|E1BXX8592 TXNDC3 "Uncharacterized protei 0.629 0.189 0.356 8.3e-13
UNIPROTKB|J9NSB4186 NME6 "Nucleoside diphosphate k 0.674 0.645 0.328 5e-12
UNIPROTKB|P56597 NME5 "Nucleoside diphosphate kinase homolog 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 6.9e-15, P = 6.9e-15
 Identities = 43/114 (37%), Positives = 60/114 (52%)

Query:    49 EYTLALVKPHAFRHVEDIEQTIQEXXXXXXXXXXXXXXPEQAAEFFITREERDPVKVPRL 108
             E TLA++KP      E+I+  I                PEQ + F++  E+   +  P L
Sbjct:    13 EKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYV--EKYGKMFFPNL 70

Query:   109 VCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMN 162
               YM SGP+  M+LA+ KAI  WL L+GP +   AK  +P SLRA YG +D+ N
Sbjct:    71 TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRN 124
GO:0004550 "nucleoside diphosphate kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006183 "GTP biosynthetic process" evidence=IEA
GO:0006228 "UTP biosynthetic process" evidence=IEA
GO:0006241 "CTP biosynthetic process" evidence=IEA
GO:0003351 "epithelial cilium movement" evidence=IEA
GO:0009296 "flagellum assembly" evidence=IEA
GO:0021591 "ventricular system development" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0043066 "negative regulation of apoptotic process" evidence=ISS
GO:0007286 "spermatid development" evidence=ISS
GO:0007283 "spermatogenesis" evidence=TAS
GO:0009116 "nucleoside metabolic process" evidence=TAS
ZFIN|ZDB-GENE-040718-221 nme5 "non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8A0 NME5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1922783 Nme5 "NME/NM23 family member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLI0 BRD8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LN92 NME5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDQ6 NME5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2018832 AT1G17410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXX8 TXNDC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSB4 NME6 "Nucleoside diphosphate kinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0I2G6NDK_HAES12, ., 7, ., 4, ., 60.31620.61790.7801yesN/A
O67528NDK_AQUAE2, ., 7, ., 4, ., 60.39310.62350.7816yesN/A
Q6N5C3NDK_RHOPA2, ., 7, ., 4, ., 60.350.65160.8285yesN/A
B0USF1NDK_HAES22, ., 7, ., 4, ., 60.32470.61790.7801yesN/A
B3Q9R4NDK_RHOPT2, ., 7, ., 4, ., 60.350.65160.8285yesN/A
O88426NDK6_RAT2, ., 7, ., 4, ., 60.37600.62920.64yesN/A
A7MU38NDK_VIBHB2, ., 7, ., 4, ., 60.32590.67970.8581yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
4th Layer2.7.4.6LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 1e-34
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 2e-32
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 1e-29
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 7e-29
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 9e-29
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 7e-28
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 7e-22
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 1e-21
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 2e-20
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 1e-19
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 3e-16
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 5e-15
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 1e-10
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 1e-10
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 3e-09
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 4e-08
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 1e-07
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 9e-05
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information 
 Score =  118 bits (297), Expect = 1e-34
 Identities = 53/115 (46%), Positives = 71/115 (61%), Gaps = 2/115 (1%)

Query: 49  EYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRL 108
           E TLA++KP A    E+IE  I E GFTIV+K+  + +PEQ ++F+   E    +  P L
Sbjct: 1   ERTLAIIKPDAVHKAEEIEDIILESGFTIVQKRKLQLSPEQCSDFYA--EHYGKMFFPHL 58

Query: 109 VCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNG 163
           V YM SGP+  MVLA+  AI  W  L+GP +  KAK  +P SLRA YG +D+ N 
Sbjct: 59  VAYMSSGPIVAMVLARHNAISYWKELLGPTNSLKAKETHPDSLRAIYGTDDLRNA 113

It belongs to the nm23 Group II genes and appears to differ from the other human NDPks in that it lacks two important catalytic site residues, and thus does not appear to possess NDP kinase activity. NDPk5 confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes, including glutathione peroxidase 5 (Gpx5). Length = 132
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 100.0
PRK14542137 nucleoside diphosphate kinase; Provisional 100.0
PRK14541140 nucleoside diphosphate kinase; Provisional 100.0
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 100.0
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 100.0
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 100.0
PRK14540134 nucleoside diphosphate kinase; Provisional 100.0
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 100.0
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 100.0
PLN02931177 nucleoside diphosphate kinase family protein 100.0
PRK14545139 nucleoside diphosphate kinase; Provisional 100.0
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 100.0
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 100.0
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 100.0
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 100.0
PRK14543169 nucleoside diphosphate kinase; Provisional 100.0
PLN02619238 nucleoside-diphosphate kinase 100.0
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 100.0
PRK14544183 nucleoside diphosphate kinase; Provisional 100.0
KOG0888|consensus156 100.0
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information 
Probab=100.00  E-value=7.2e-45  Score=279.67  Aligned_cols=128  Identities=34%  Similarity=0.559  Sum_probs=125.6

Q ss_pred             eEEEEEEeCccccchhHHHHHHHHcCCeEEEEEeeecCHHHHHHhcccccccCCCcccccceeeecCcEEEEEEeecchh
Q psy1618          49 EYTLALVKPHAFRHVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAKQKAI  128 (178)
Q Consensus        49 E~Tl~lIKPdav~~~g~II~~i~~~Gf~Iv~~k~~~ls~e~a~~~y~~~~~~~~~~~~~lv~~mtsGpvval~L~g~nAV  128 (178)
                      |+||+|||||+++++|+||++|+++||.|+++||++||+++|++||.  +|++++||++|+++|+|||+++|+|.|+|||
T Consensus         1 erTl~iIKPdav~~~g~Il~~i~~~Gf~I~~~k~~~lt~~~a~~~y~--~~~gk~f~~~Lv~~m~sgp~va~~l~g~nav   78 (131)
T cd04415           1 EKTLALIKPDAYSKIGKIIQIIEDAGFTITKAKMTKLSRKEAQDFYA--EHQSKPFYNELVQFMTSGPIVAMELVGDDAI   78 (131)
T ss_pred             CeEEEEECcHHHHhHHHHHHHHHHCCCEEEEeeeecCCHHHHHHHHH--HhCCCCchHHHHHHHhcCCeEEEEEECCcHH
Confidence            68999999999999999999999999999999999999999999999  9999999999999999999999999999999


Q ss_pred             HHHHhhcCCCChhhhhhcCCCChhhccccCCCceEEeeCCCc-ccccccCC
Q psy1618         129 RRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQIL-TKQKEFTL  178 (178)
Q Consensus       129 ~~~r~l~Gp~dp~~A~~~~P~sLRa~yG~~~~~NavH~Sd~~-~~~re~~l  178 (178)
                      ++||+++||++|..|+...|+|||++||.+.++|+|||||++ +|+|||.+
T Consensus        79 ~~~R~l~Gpt~p~~A~~~~p~siR~~fg~~~~~N~vH~Sds~e~a~~Ei~~  129 (131)
T cd04415          79 SEWRKLLGPTNSSVARSDAPNSIRALFGTDGTRNAAHGSDSVASAARELEF  129 (131)
T ss_pred             HHHHHHhCCCChHHhhccCCCcchhhhcccccceeEECCCCHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999 99999864

The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>KOG0888|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 2e-09
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 3e-05
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 3e-05
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 5e-05
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-04
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 4e-04
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure 
Iteration: 1

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
Query: 49  EYTLALVKPHAFRHV---EDIEQTIQEXXXXXXXXXXXXXXPEQAAEFFITREERDPVKV 105
           E TL +VKP A       + +++ IQE              PE+A EF+    ER   + 
Sbjct: 4   ERTLIIVKPDAMEKGALGKILDRFIQEGFQIKALKMFRFT-PEKAGEFYYVHRERPFFQ- 61
Query: 106 PRLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMN 162
             LV +M SGPV   VL  + AI+R   ++GP D ++A+++ P S+RA++G +   N
Sbjct: 62  -ELVEFMSSGPVVAAVLEGEDAIKRVREIIGPTDSEEARKVAPNSIRAQFGTDKGKN 117
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 1e-20
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 3e-18
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 3e-18
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 5e-18
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 3e-17
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 6e-17
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 6e-17
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 1e-16
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 1e-16
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 1e-16
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 2e-16
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 2e-16
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 2e-16
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 2e-16
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 3e-16
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 3e-16
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 3e-16
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 4e-16
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 5e-16
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 5e-16
3js9_A156 Nucleoside diphosphate kinase family protein; niai 5e-16
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 6e-16
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 6e-16
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 7e-16
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 8e-16
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 1e-15
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 1e-15
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 2e-15
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 5e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
 Score = 82.2 bits (204), Expect = 1e-20
 Identities = 44/112 (39%), Positives = 65/112 (58%), Gaps = 4/112 (3%)

Query: 49  EYTLALVKPHAFR--HVEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVP 106
           E TL +VKP A     +  I     ++GF I   K F+FTPE+A EF+    ER P    
Sbjct: 4   ERTLIIVKPDAMEKGALGKILDRFIQEGFQIKALKMFRFTPEKAGEFYYVHRER-PF-FQ 61

Query: 107 RLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVN 158
            LV +M SGPV   VL  + AI+R   ++GP D ++A+++ P S+RA++G +
Sbjct: 62  ELVEFMSSGPVVAAVLEGEDAIKRVREIIGPTDSEEARKVAPNSIRAQFGTD 113
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 100.0
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 100.0
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niai 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 100.0
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 100.0
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.95
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
Probab=100.00  E-value=2.2e-46  Score=290.63  Aligned_cols=130  Identities=35%  Similarity=0.557  Sum_probs=126.4

Q ss_pred             cceEEEEEEeCccccc--hhHHHHHHHHcCCeEEEEEeeecCHHHHHHhcccccccCCCcccccceeeecCcEEEEEEee
Q psy1618          47 CYEYTLALVKPHAFRH--VEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAK  124 (178)
Q Consensus        47 ~~E~Tl~lIKPdav~~--~g~II~~i~~~Gf~Iv~~k~~~ls~e~a~~~y~~~~~~~~~~~~~lv~~mtsGpvval~L~g  124 (178)
                      .+|+||+|||||++.+  +|+||++|+++||.|+++||++||+++|++||.  +|++++||++|++||+||||++|+|.|
T Consensus         2 ~~e~Tl~iIKPdav~~~~~g~Ii~~i~~~Gf~I~~~k~~~ls~e~a~~~Y~--~~~~kpff~~Lv~~mtSGPvva~vl~g   79 (142)
T 3ztp_A            2 AVERTLIIVKPDAMEKGALGKILDRFIQEGFQIKALKMFRFTPEKAGEFYY--VHRERPFFQELVEFMSSGPVVAAVLEG   79 (142)
T ss_dssp             CEEEEEEEECHHHHHHTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTG--GGTTSTTHHHHHHHHTSSCEEEEEEEE
T ss_pred             ccceEEEEEChHHHhcccHHHHHHHHHHcCCEEEEEeeccCCHHHHHHHHH--HhcCCchHHHHHHHhcCCCEEEEEEeC
Confidence            3699999999999986  699999999999999999999999999999999  999999999999999999999999999


Q ss_pred             cchhHHHHhhcCCCChhhhhhcCCCChhhccccCCCceEEeeCCCc-ccccccCC
Q psy1618         125 QKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQIL-TKQKEFTL  178 (178)
Q Consensus       125 ~nAV~~~r~l~Gp~dp~~A~~~~P~sLRa~yG~~~~~NavH~Sd~~-~~~re~~l  178 (178)
                      +|||+.||+++|||||..|+...|+|||++||.+..+|+|||||++ +|+|||++
T Consensus        80 ~naV~~~R~l~G~t~p~~A~~~~pgtiR~~fg~~~~~N~vHgSDs~esA~rEi~~  134 (142)
T 3ztp_A           80 EDAIKRVREIIGPTDSEEARKVAPNSIRAQFGTDKGKNAIHASDSPESAQYEICF  134 (142)
T ss_dssp             ETHHHHHHHHHCCSSHHHHHHHCTTSHHHHHCCSSSSCSEEECCSHHHHHHHHHH
T ss_pred             CCHHHHHHHhcCCCCHHHhhhcCCCChHHHhCCCCCceeEEeCCCHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999 99999863
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 1e-22
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-22
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 2e-22
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 3e-21
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 5e-21
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 1e-20
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-20
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 1e-19
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 1e-19
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-19
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-18
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-18
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-17
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-17
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 1e-15
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 2e-15
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 86.2 bits (213), Expect = 1e-22
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 49  EYTLALVKPHAFRH--VEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVP 106
           E T   +KP   +   V +I +  ++KGF +V  K  + + E   + +I  + +D    P
Sbjct: 4   ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYI--DLKDRPFFP 61

Query: 107 RLVCYMVSGPVRVMVLAKQKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMN 162
            LV YM SGPV  MV      ++    ++G  +P  +K   P ++R  + +    N
Sbjct: 62  GLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSK---PGTIRGDFCIQVGRN 114
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 100.0
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 100.0
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens), NDK4 [TaxId: 9606]

Probab=100.00  E-value=2.1e-45  Score=283.47  Aligned_cols=127  Identities=30%  Similarity=0.407  Sum_probs=123.4

Q ss_pred             cceEEEEEEeCccccc--hhHHHHHHHHcCCeEEEEEeeecCHHHHHHhcccccccCCCcccccceeeecCcEEEEEEee
Q psy1618          47 CYEYTLALVKPHAFRH--VEDIEQTIQEKGFTIVKKKTFKFTPEQAAEFFITREERDPVKVPRLVCYMVSGPVRVMVLAK  124 (178)
Q Consensus        47 ~~E~Tl~lIKPdav~~--~g~II~~i~~~Gf~Iv~~k~~~ls~e~a~~~y~~~~~~~~~~~~~lv~~mtsGpvval~L~g  124 (178)
                      ..|+||+|||||++.+  +|+||++|+++||.|+++|+++||+++|.+||.  ++++++||++|++||+||||++|+|.|
T Consensus         4 ~~E~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~Iv~~k~~~lt~e~a~~~Y~--~~~~k~f~~~lv~~m~sGp~~a~~l~g   81 (143)
T d1ehwa_           4 TRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQ--DLRRKPFYPALIRYMSSGPVVAMVWEG   81 (143)
T ss_dssp             GGCEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTG--GGTTSTTHHHHHHHHTSSCEEEEEEES
T ss_pred             ccceEEEEECchhhhcCCHHHHHHHHHHcCCEEeeeeeeecCHHHHHHHHH--HHhcchhhhhhhheecCCCEEEEecch
Confidence            4799999999999987  699999999999999999999999999999999  999999999999999999999999999


Q ss_pred             cchhHHHHhhcCCCChhhhhhcCCCChhhccccCCCceEEeeCCCc-ccccccCC
Q psy1618         125 QKAIRRWLHLMGPVDPDKAKRIYPLSLRAKYGVNDIMNGSWVLQIL-TKQKEFTL  178 (178)
Q Consensus       125 ~nAV~~~r~l~Gp~dp~~A~~~~P~sLRa~yG~~~~~NavH~Sd~~-~~~re~~l  178 (178)
                      +|||..||.++||+||..|   .|+|||++||++.++|+|||||++ +|+|||++
T Consensus        82 ~naV~~~R~l~Gpt~p~~a---~p~siR~~yg~~~~~N~vH~Sds~e~A~~Ei~~  133 (143)
T d1ehwa_          82 YNVVRASRAMIGHTDSAEA---APGTIRGDFSVHISRNVIHASDSVEGAQREIQL  133 (143)
T ss_dssp             TTHHHHHHHHHCCSSGGGS---CTTSHHHHHCCCSSCCSEEECSSHHHHHHHHHH
T ss_pred             hhHHHHHHHHhcCCCcccC---CCCCcHhhhhCcccCCCeECCCCHHHHHHHHHH
Confidence            9999999999999999999   799999999999999999999999 99999864
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure