Diaphorina citri psyllid: psy16200


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDND
cccHHHHHccccEEEEcccccccccccccccccccccEEEcccHHHHHHcccccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHcccEEECccccEEEEEcccEEEEEEEEEccccccccEEEccccEEEEEccEEEEcccccccccc
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTE*******VEDEEQRIKLKANYIISAFGSTL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dihydropyrimidine dehydrogenase [NADP(+)] Involved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine.confidentQ5R895
Dihydropyrimidine dehydrogenase [NADP(+)] Involved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine.confidentQ28007
Dihydropyrimidine dehydrogenase [NADP(+)] Involved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine.confidentQ6NYG8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050661 [MF]NADP bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0007623 [BP]circadian rhythmprobableGO:0048511, GO:0008150
GO:0006214 [BP]thymidine catabolic processprobableGO:0008152, GO:0044248, GO:0072529, GO:0009164, GO:0006807, GO:0044237, GO:0046135, GO:0009120, GO:1901360, GO:0072527, GO:0006139, GO:1901575, GO:0071704, GO:1901361, GO:0044281, GO:0009987, GO:0006725, GO:0044710, GO:0046700, GO:0046121, GO:0046127, GO:0009116, GO:0046125, GO:0034655, GO:0009056, GO:0046104, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0006213, GO:1901657, GO:0019439, GO:0008150, GO:1901658, GO:1901565
GO:0006210 [BP]thymine catabolic processprobableGO:0044248, GO:0072529, GO:0034641, GO:0006807, GO:0044281, GO:0046113, GO:1901360, GO:0072527, GO:0006139, GO:1901575, GO:0006208, GO:0006206, GO:0019859, GO:0071704, GO:1901361, GO:0009987, GO:0006725, GO:0044710, GO:0046700, GO:0009112, GO:0008150, GO:0008152, GO:0009056, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044270, GO:0044237, GO:1901565
GO:0006212 [BP]uracil catabolic processprobableGO:0044248, GO:0072529, GO:0034641, GO:0006807, GO:0044281, GO:0046113, GO:1901360, GO:0072527, GO:0006139, GO:1901575, GO:0006208, GO:0006206, GO:0071704, GO:1901361, GO:0009987, GO:0006725, GO:0044710, GO:0046700, GO:0009112, GO:0008150, GO:0008152, GO:0009056, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044270, GO:0019860, GO:0044237, GO:1901565
GO:0002058 [MF]uracil bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:0002054, GO:0002061, GO:1901363
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0050660 [MF]flavin adenine dinucleotide bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0010181 [MF]FMN bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:1901265, GO:0003674, GO:0043167, GO:1901363, GO:0032553, GO:0005488
GO:0007584 [BP]response to nutrientprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0006145 [BP]purine nucleobase catabolic processprobableGO:0044248, GO:0034641, GO:0006807, GO:0044281, GO:0046113, GO:0072521, GO:0072523, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0071704, GO:0009987, GO:0006725, GO:0044710, GO:0046700, GO:0009112, GO:0008150, GO:0008152, GO:0009056, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:0044270, GO:0044237, GO:0019439, GO:0006144, GO:1901565

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GTE, chain A
Confidence level:very confident
Coverage over the Query: 2-180
View the alignment between query and template
View the model in PyMOL