Psyllid ID: psy16200


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDND
cccHHHHHccccEEEEcccccccccccccccccccccEEEcccHHHHHHcccccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHcccEEEEccccEEEEEcccEEEEEEEEEccccccccEEEccccEEEEEccEEEEcccccccccc
ccHHHHHHccccEEEEcccccEEcccHHHccccccccEEEHHHHHHHHHHHHccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccHHHccccHHHHHHHHHcccEEEccEEEEEEEEEccEEEEEEEEEEEEEcccEEEEEEEEEEEEEccEEEEcccEEccccc
mptlklrkdgyTAIFIGigkpnanvipIFQGlteemgfytsktflprvatsskkglcggckkeslpilkGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKgctniravPEEVQLAWEEkceflpfmspvqvdvkdnkiagmqfnrteqnekgewveDEEQRIKLKANYIISAFgstlldnd
mptlklrkdgYTAIFigigkpnaNVIPIFQGLTEEMGFYTSKTFLPRVATSskkglcggckkeslpiLKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFnrteqnekgewvEDEEQRIKLKANYIISafgstlldnd
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATsskkglcggckkeslPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDND
*******KDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQ*****************QRIKLKANYIISAFGST*****
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTE*******VEDEEQRIKLKANYIISAF*STL****
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQ*********EEQRIKLKANYIISAFGSTLLDND
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDND
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q8CHR6 1025 Dihydropyrimidine dehydro yes N/A 0.950 0.169 0.670 5e-61
O89000 1025 Dihydropyrimidine dehydro yes N/A 0.950 0.169 0.664 2e-60
Q5R895 1025 Dihydropyrimidine dehydro yes N/A 0.950 0.169 0.647 2e-59
Q12882 1025 Dihydropyrimidine dehydro yes N/A 0.950 0.169 0.647 3e-59
Q28943 1025 Dihydropyrimidine dehydro yes N/A 0.950 0.169 0.647 6e-59
Q28007 1025 Dihydropyrimidine dehydro yes N/A 0.950 0.169 0.653 2e-57
Q18164 1059 Dihydropyrimidine dehydro yes N/A 0.967 0.167 0.601 3e-56
A8XKG6 1053 Probable dihydropyrimidin N/A N/A 0.967 0.168 0.601 5e-56
Q6NYG8 1022 Dihydropyrimidine dehydro yes N/A 0.950 0.170 0.636 7e-55
Q55FT1 1009 Dihydropyrimidine dehydro yes N/A 0.939 0.170 0.545 3e-51
>sp|Q8CHR6|DPYD_MOUSE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Mus musculus GN=Dpyd PE=2 SV=1 Back     alignment and function desciption
 Score =  233 bits (594), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 136/176 (77%), Gaps = 2/176 (1%)

Query: 6   LRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESL 65
           L+++GY A FIGIG P      IFQGLT+  GFYTSK FLP VA SSK G+C  C    L
Sbjct: 271 LKENGYRAAFIGIGLPEPKKDHIFQGLTQVQGFYTSKDFLPLVAKSSKTGMCA-CH-SPL 328

Query: 66  PILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFL 125
           P ++G VIVLGAGDTAFDCATSALRCGA +V +VFRKG  NIRAVPEE++LA EEKCEFL
Sbjct: 329 PSIRGAVIVLGAGDTAFDCATSALRCGALRVFIVFRKGFVNIRAVPEEMELAKEEKCEFL 388

Query: 126 PFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLD 181
           PF+SP +V VKD KI  MQF RTEQ+E G WVEDEEQ ++LKA+ +ISAFGS L D
Sbjct: 389 PFLSPRKVIVKDGKIVAMQFVRTEQDETGNWVEDEEQTVRLKADVVISAFGSVLED 444




Involved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 2
>sp|O89000|DPYD_RAT Dihydropyrimidine dehydrogenase [NADP(+)] OS=Rattus norvegicus GN=Dpyd PE=2 SV=1 Back     alignment and function description
>sp|Q5R895|DPYD_PONAB Dihydropyrimidine dehydrogenase [NADP(+)] OS=Pongo abelii GN=DPYD PE=2 SV=1 Back     alignment and function description
>sp|Q12882|DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Homo sapiens GN=DPYD PE=1 SV=2 Back     alignment and function description
>sp|Q28943|DPYD_PIG Dihydropyrimidine dehydrogenase [NADP(+)] OS=Sus scrofa GN=DPYD PE=1 SV=1 Back     alignment and function description
>sp|Q28007|DPYD_BOVIN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Bos taurus GN=DPYD PE=1 SV=1 Back     alignment and function description
>sp|Q18164|DPYD_CAEEL Dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis elegans GN=dpyd-1 PE=3 SV=2 Back     alignment and function description
>sp|A8XKG6|DPYD_CAEBR Probable dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis briggsae GN=dpyd-1 PE=3 SV=2 Back     alignment and function description
>sp|Q6NYG8|DPYD_DANRE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Danio rerio GN=dpyd PE=2 SV=1 Back     alignment and function description
>sp|Q55FT1|DPYD_DICDI Dihydropyrimidine dehydrogenase [NADP(+)] OS=Dictyostelium discoideum GN=pyd1 PE=2 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
MGI|MGI:2139667 1025 Dpyd "dihydropyrimidine dehydr 0.978 0.174 0.618 1.8e-51
RGD|621218 1025 Dpyd "dihydropyrimidine dehydr 0.950 0.169 0.630 5e-51
UNIPROTKB|O89000 1025 Dpyd "Dihydropyrimidine dehydr 0.950 0.169 0.630 5e-51
UNIPROTKB|Q12882 1025 DPYD "Dihydropyrimidine dehydr 0.950 0.169 0.613 2.8e-50
UNIPROTKB|Q5R895 1025 DPYD "Dihydropyrimidine dehydr 0.950 0.169 0.613 2.8e-50
UNIPROTKB|F1S550 949 DPYD "Dihydropyrimidine dehydr 0.950 0.183 0.607 7.4e-50
UNIPROTKB|F1N549 1025 DPYD "Dihydropyrimidine dehydr 0.950 0.169 0.613 9.8e-50
UNIPROTKB|Q28943 1025 DPYD "Dihydropyrimidine dehydr 0.950 0.169 0.607 9.8e-50
ZFIN|ZDB-GENE-040426-2459 1022 dpydb "dihydropyrimidine dehyd 0.950 0.170 0.602 1.6e-49
FB|FBgn0086450 1031 su(r) "suppressor of rudimenta 0.972 0.172 0.595 2.1e-49
MGI|MGI:2139667 Dpyd "dihydropyrimidine dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 543 (196.2 bits), Expect = 1.8e-51, P = 1.8e-51
 Identities = 112/181 (61%), Positives = 129/181 (71%)

Query:     1 MPTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATXXXXXXXXXX 60
             M    L+++GY A FIGIG P      IFQGLT+  GFYTSK FLP VA           
Sbjct:   266 MTLSSLKENGYRAAFIGIGLPEPKKDHIFQGLTQVQGFYTSKDFLPLVAKSSKTGMCACH 325

Query:    61 XXXXXPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEE 120
                  P ++G VIVLGAGDTAFDCATSALRCGA +V +VFRKG  NIRAVPEE++LA EE
Sbjct:   326 SPL--PSIRGAVIVLGAGDTAFDCATSALRCGALRVFIVFRKGFVNIRAVPEEMELAKEE 383

Query:   121 KCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLL 180
             KCEFLPF+SP +V VKD KI  MQF RTEQ+E G WVEDEEQ ++LKA+ +ISAFGS L 
Sbjct:   384 KCEFLPFLSPRKVIVKDGKIVAMQFVRTEQDETGNWVEDEEQTVRLKADVVISAFGSVLE 443

Query:   181 D 181
             D
Sbjct:   444 D 444




GO:0000166 "nucleotide binding" evidence=IEA
GO:0002058 "uracil binding" evidence=ISO
GO:0003824 "catalytic activity" evidence=IEA
GO:0004152 "dihydroorotate dehydrogenase activity" evidence=IEA
GO:0004158 "dihydroorotate oxidase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISO
GO:0005829 "cytosol" evidence=ISO;IDA
GO:0006145 "purine nucleobase catabolic process" evidence=ISO
GO:0006208 "pyrimidine nucleobase catabolic process" evidence=ISO;IDA
GO:0006210 "thymine catabolic process" evidence=ISO
GO:0006212 "uracil catabolic process" evidence=ISO
GO:0006214 "thymidine catabolic process" evidence=ISO
GO:0006222 "UMP biosynthetic process" evidence=IEA
GO:0007584 "response to nutrient" evidence=ISO
GO:0007623 "circadian rhythm" evidence=ISO
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0017113 "dihydropyrimidine dehydrogenase (NADP+) activity" evidence=ISO;IDA
GO:0019860 "uracil metabolic process" evidence=ISO
GO:0042493 "response to drug" evidence=ISO
GO:0042803 "protein homodimerization activity" evidence=ISO
GO:0046872 "metal ion binding" evidence=IEA
GO:0050661 "NADP binding" evidence=ISO
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=ISO;IDA
RGD|621218 Dpyd "dihydropyrimidine dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O89000 Dpyd "Dihydropyrimidine dehydrogenase [NADP(+)]" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q12882 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R895 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1S550 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N549 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q28943 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2459 dpydb "dihydropyrimidine dehydrogenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0086450 su(r) "suppressor of rudimentary" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R895DPYD_PONAB1, ., 3, ., 1, ., 20.64770.95080.1697yesN/A
Q6NYG8DPYD_DANRE1, ., 3, ., 1, ., 20.63630.95080.1702yesN/A
Q28943DPYD_PIG1, ., 3, ., 1, ., 20.64770.95080.1697yesN/A
Q12882DPYD_HUMAN1, ., 3, ., 1, ., 20.64770.95080.1697yesN/A
Q55FT1DPYD_DICDI1, ., 3, ., 1, ., 20.54590.93980.1704yesN/A
Q28007DPYD_BOVIN1, ., 3, ., 1, ., 20.65340.95080.1697yesN/A
O89000DPYD_RAT1, ., 3, ., 1, ., 20.66470.95080.1697yesN/A
Q18164DPYD_CAEEL1, ., 3, ., 1, ., 20.60110.96720.1671yesN/A
Q8CHR6DPYD_MOUSE1, ., 3, ., 1, ., 20.67040.95080.1697yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 3e-20
PRK12771 564 PRK12771, PRK12771, putative glutamate synthase (N 5e-16
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 7e-14
PRK09853 1019 PRK09853, PRK09853, putative selenate reductase su 1e-13
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 1e-13
PRK12775 1006 PRK12775, PRK12775, putative trifunctional 2-polyp 3e-13
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 5e-13
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 5e-13
PRK12769654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 8e-12
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 3e-11
TIGR03315 1012 TIGR03315, Se_ygfK, putative selenate reductase, Y 3e-11
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 4e-11
PRK12809639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 5e-08
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 5e-08
PRK12814 652 PRK12814, PRK12814, putative NADPH-dependent gluta 9e-08
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 1e-06
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 4e-06
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
 Score = 86.4 bits (215), Expect = 3e-20
 Identities = 59/179 (32%), Positives = 84/179 (46%), Gaps = 23/179 (12%)

Query: 8   KDGYTAIFIGIG--KPNANVIPIFQGLTEEM-GFYTSKTFLPRVATSSKKGLCGGCKKES 64
           + GY A+FIG G   P    IP   G  E + G Y++  FL RV                
Sbjct: 223 RAGYDAVFIGTGAGLPRFLGIP---G--ENLGGVYSAVDFLTRVNQ----------AVAD 267

Query: 65  LPILKG-TVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCE 123
             +  G  V+V+G G+TA D A +A R GA  V +V+R+G   + A  EEV+ A EE  E
Sbjct: 268 YDLPVGKRVVVIGGGNTAMDAARTAKRLGAESVTIVYRRGREEMPASEEEVEHAKEEGVE 327

Query: 124 FLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGE----WVEDEEQRIKLKANYIISAFGST 178
           F    +PV++   + ++ G++F R E  E        V  E     L A+ +I A G T
Sbjct: 328 FEWLAAPVEILGDEGRVTGVEFVRMELGEPDASGRRRVPIEGSEFTLPADLVIKAIGQT 386


Length = 457

>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
PRK12831464 putative oxidoreductase; Provisional 99.94
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.94
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.94
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.93
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.93
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.92
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.91
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.91
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.9
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.9
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.9
PLN02852 491 ferredoxin-NADP+ reductase 99.9
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.89
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.89
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.87
PRK13984604 putative oxidoreductase; Provisional 99.87
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.85
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.85
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 99.84
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.83
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.82
PRK06370 463 mercuric reductase; Validated 99.8
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.79
TIGR02053 463 MerA mercuric reductase. This model represents the 99.78
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.78
PRK07846 451 mycothione reductase; Reviewed 99.77
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.77
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 99.77
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 99.77
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 99.77
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 99.77
PRK10262321 thioredoxin reductase; Provisional 99.76
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 99.76
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 99.75
KOG0399|consensus2142 99.75
PLN02507 499 glutathione reductase 99.75
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 99.75
PRK07845 466 flavoprotein disulfide reductase; Reviewed 99.75
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 99.75
PTZ00058 561 glutathione reductase; Provisional 99.75
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 99.74
KOG0404|consensus322 99.74
PTZ00153 659 lipoamide dehydrogenase; Provisional 99.74
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 99.74
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.73
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.73
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.73
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 99.72
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 99.72
PRK06116 450 glutathione reductase; Validated 99.72
PRK14727 479 putative mercuric reductase; Provisional 99.72
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.72
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.72
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.72
PLN02546 558 glutathione reductase 99.71
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.71
PRK13748 561 putative mercuric reductase; Provisional 99.71
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.7
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.7
PTZ00052 499 thioredoxin reductase; Provisional 99.7
PRK14694 468 putative mercuric reductase; Provisional 99.7
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 99.7
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.69
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 99.69
KOG1335|consensus 506 99.66
PRK09564 444 coenzyme A disulfide reductase; Reviewed 99.65
PTZ00188 506 adrenodoxin reductase; Provisional 99.65
PRK13512 438 coenzyme A disulfide reductase; Provisional 99.64
KOG0405|consensus 478 99.64
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.63
KOG1336|consensus 478 99.61
KOG4716|consensus 503 99.59
KOG1800|consensus 468 99.58
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.56
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.54
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 99.48
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 99.47
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.44
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.43
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.37
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.36
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.28
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.23
KOG1346|consensus 659 99.16
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.0
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 98.93
KOG2495|consensus 491 98.85
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 98.75
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 98.72
KOG1399|consensus 448 98.7
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.66
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.55
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.48
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.47
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.43
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 98.43
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.41
COG2081 408 Predicted flavoproteins [General function predicti 98.38
PRK12770 352 putative glutamate synthase subunit beta; Provisio 98.36
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 98.34
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 98.31
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 98.3
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 98.29
PRK10262 321 thioredoxin reductase; Provisional 98.28
TIGR02032 295 GG-red-SF geranylgeranyl reductase family. This mo 98.27
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.24
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.23
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.23
PRK06847 375 hypothetical protein; Provisional 98.23
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.22
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.21
PRK07236 386 hypothetical protein; Provisional 98.2
PRK08244 493 hypothetical protein; Provisional 98.2
PRK07845 466 flavoprotein disulfide reductase; Reviewed 98.19
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.19
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 98.19
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.18
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.18
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 98.17
PRK06184 502 hypothetical protein; Provisional 98.17
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.17
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 98.15
PRK12831 464 putative oxidoreductase; Provisional 98.15
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.14
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.13
PRK06185 407 hypothetical protein; Provisional 98.12
PRK06834 488 hypothetical protein; Provisional 98.11
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.1
PRK11749 457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.1
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.08
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.07
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.06
PRK08274 466 tricarballylate dehydrogenase; Validated 98.06
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 98.04
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 98.03
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 98.02
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 98.02
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 98.02
PRK10015 429 oxidoreductase; Provisional 98.01
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.01
PRK06126 545 hypothetical protein; Provisional 98.0
PRK10157 428 putative oxidoreductase FixC; Provisional 97.99
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.99
PLN02463 447 lycopene beta cyclase 97.98
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.98
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 97.96
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.95
PRK08163 396 salicylate hydroxylase; Provisional 97.95
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 97.95
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.95
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 97.95
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 97.95
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.94
PRK07588 391 hypothetical protein; Provisional 97.93
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.91
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.9
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.9
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.9
PRK05868 372 hypothetical protein; Validated 97.89
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 97.89
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.88
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.88
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 97.88
PRK06475 400 salicylate hydroxylase; Provisional 97.87
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 97.87
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.87
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.87
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 97.86
PRK09126 392 hypothetical protein; Provisional 97.86
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.86
PRK11445 351 putative oxidoreductase; Provisional 97.86
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 97.84
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.83
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 97.81
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.81
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.81
PLN02852 491 ferredoxin-NADP+ reductase 97.8
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 97.79
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 97.79
PRK14694 468 putative mercuric reductase; Provisional 97.79
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 97.78
PRK07190 487 hypothetical protein; Provisional 97.78
PRK06753 373 hypothetical protein; Provisional 97.77
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.76
PLN02985 514 squalene monooxygenase 97.75
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 97.75
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 97.74
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.74
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.71
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.71
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.7
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.69
PRK07045 388 putative monooxygenase; Reviewed 97.69
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.68
COG0492 305 TrxB Thioredoxin reductase [Posttranslational modi 97.68
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.68
PRK06116 450 glutathione reductase; Validated 97.68
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 97.67
COG0579 429 Predicted dehydrogenase [General function predicti 97.66
PRK07121 492 hypothetical protein; Validated 97.65
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 97.65
PRK06370 463 mercuric reductase; Validated 97.64
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.64
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.64
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 97.63
PRK13748 561 putative mercuric reductase; Provisional 97.62
PRK06175 433 L-aspartate oxidase; Provisional 97.62
PRK13984 604 putative oxidoreductase; Provisional 97.61
PRK06996 398 hypothetical protein; Provisional 97.61
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.61
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.6
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.6
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.6
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 97.6
PRK08013 400 oxidoreductase; Provisional 97.6
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 97.58
PRK14727 479 putative mercuric reductase; Provisional 97.57
PLN02661 357 Putative thiazole synthesis 97.56
PLN02464 627 glycerol-3-phosphate dehydrogenase 97.56
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 97.56
TIGR02053 463 MerA mercuric reductase. This model represents the 97.55
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 97.55
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.54
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 97.54
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.54
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 97.52
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.51
PRK07538 413 hypothetical protein; Provisional 97.5
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 97.5
PRK08275 554 putative oxidoreductase; Provisional 97.5
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 97.49
TIGR00275 400 flavoprotein, HI0933 family. The model when search 97.48
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.47
KOG1399|consensus 448 97.46
PLN02507 499 glutathione reductase 97.45
PLN02697 529 lycopene epsilon cyclase 97.45
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 97.44
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 97.42
PRK09897 534 hypothetical protein; Provisional 97.42
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.42
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.41
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.41
PRK08401 466 L-aspartate oxidase; Provisional 97.41
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.39
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.37
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.37
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 97.37
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 97.36
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.35
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.35
PRK07804 541 L-aspartate oxidase; Provisional 97.34
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.33
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 97.33
PRK08071 510 L-aspartate oxidase; Provisional 97.33
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.29
PRK07395 553 L-aspartate oxidase; Provisional 97.29
PRK12842 574 putative succinate dehydrogenase; Reviewed 97.28
KOG1298|consensus 509 97.26
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.23
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.22
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.19
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 97.18
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.15
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 97.14
PTZ00052 499 thioredoxin reductase; Provisional 97.13
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 97.13
PRK07512 513 L-aspartate oxidase; Provisional 97.11
PLN02815 594 L-aspartate oxidase 97.08
PLN02546 558 glutathione reductase 97.07
PRK08294 634 phenol 2-monooxygenase; Provisional 97.07
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.06
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.05
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.05
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 97.02
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.01
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 96.99
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.99
KOG0029|consensus 501 96.99
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 96.98
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 96.96
KOG1336|consensus 478 96.93
KOG2404|consensus 477 96.92
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.89
PRK09077 536 L-aspartate oxidase; Provisional 96.86
KOG0399|consensus 2142 96.83
PRK07233 434 hypothetical protein; Provisional 96.81
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.76
PRK11883 451 protoporphyrinogen oxidase; Reviewed 96.76
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 96.75
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 96.73
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 96.69
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.68
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 96.63
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.61
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 96.55
PTZ00188 506 adrenodoxin reductase; Provisional 96.54
KOG2852|consensus 380 96.54
PLN02268 435 probable polyamine oxidase 96.49
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 96.48
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 96.46
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 96.45
PRK06719157 precorrin-2 dehydrogenase; Validated 96.42
KOG2311|consensus 679 96.41
PRK11728 393 hydroxyglutarate oxidase; Provisional 96.4
PRK07208 479 hypothetical protein; Provisional 96.35
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.33
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 96.33
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.33
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 96.31
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.21
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.18
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 96.17
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 96.16
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 96.15
PLN02576 496 protoporphyrinogen oxidase 96.13
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.13
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 96.12
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.12
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 96.11
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 96.1
PRK12416 463 protoporphyrinogen oxidase; Provisional 96.1
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.09
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 96.09
KOG0042|consensus 680 96.06
COG3349 485 Uncharacterized conserved protein [Function unknow 96.05
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 96.03
PRK07846 451 mycothione reductase; Reviewed 96.02
KOG2495|consensus 491 95.97
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.95
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.95
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 95.92
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 95.88
KOG2415|consensus 621 95.86
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.83
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 95.8
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 95.8
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 95.8
COG3573 552 Predicted oxidoreductase [General function predict 95.78
PF13434 341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 95.71
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 95.7
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 95.67
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.64
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 95.61
PRK15116 268 sulfur acceptor protein CsdL; Provisional 95.54
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.51
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.5
PLN02676 487 polyamine oxidase 95.49
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.43
PTZ00367 567 squalene epoxidase; Provisional 95.4
KOG0685|consensus 498 95.4
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 95.38
PLN02529 738 lysine-specific histone demethylase 1 95.38
KOG2614|consensus 420 95.37
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.37
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.36
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 95.35
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 95.33
PTZ00383 497 malate:quinone oxidoreductase; Provisional 95.32
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 95.2
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.19
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 95.19
KOG2844|consensus 856 95.19
PLN02612 567 phytoene desaturase 95.13
PRK13977 576 myosin-cross-reactive antigen; Provisional 95.1
PRK05257 494 malate:quinone oxidoreductase; Validated 95.08
PLN02328 808 lysine-specific histone demethylase 1 homolog 95.06
PRK09897 534 hypothetical protein; Provisional 95.04
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.01
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 95.01
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 95.0
PLN02487 569 zeta-carotene desaturase 94.94
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 94.89
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.88
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 94.83
PLN02568 539 polyamine oxidase 94.82
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 94.8
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.8
PRK10637 457 cysG siroheme synthase; Provisional 94.76
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 94.75
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 94.73
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.69
PF00732 296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 94.69
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.69
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.68
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 94.68
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.66
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.66
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.64
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 94.61
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 94.58
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 94.56
cd01484 234 E1-2_like Ubiquitin activating enzyme (E1), repeat 94.55
PRK13339 497 malate:quinone oxidoreductase; Reviewed 94.54
KOG4716|consensus 503 94.53
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 94.53
KOG2820|consensus 399 94.53
PLN03000 881 amine oxidase 94.52
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.5
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 94.45
PRK08328231 hypothetical protein; Provisional 94.44
PRK12549284 shikimate 5-dehydrogenase; Reviewed 94.42
cd01489 312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 94.4
KOG2013|consensus 603 94.38
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 94.37
PRK12842 574 putative succinate dehydrogenase; Reviewed 94.32
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.3
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 94.29
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 94.29
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.28
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 94.26
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 94.24
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 94.23
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.22
KOG0405|consensus 478 94.18
cd01488 291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 94.18
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 94.14
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.13
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 94.11
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 94.07
PTZ00058 561 glutathione reductase; Provisional 94.06
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 94.05
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.04
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 94.04
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.01
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 93.99
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 93.99
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 93.97
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 93.96
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 93.95
KOG3851|consensus 446 93.93
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.93
PRK13977 576 myosin-cross-reactive antigen; Provisional 93.85
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.84
cd01486 307 Apg7 Apg7 is an E1-like protein, that activates tw 93.83
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 93.82
PRK12548289 shikimate 5-dehydrogenase; Provisional 93.8
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 93.79
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 93.74
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 93.71
PRK08306296 dipicolinate synthase subunit A; Reviewed 93.7
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 93.7
cd00755 231 YgdL_like Family of activating enzymes (E1) of ubi 93.7
PRK08223 287 hypothetical protein; Validated 93.68
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 93.61
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 93.59
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.57
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 93.47
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 93.46
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 93.45
KOG0404|consensus 322 93.45
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 93.43
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 93.42
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.42
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.41
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 93.36
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 93.34
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 93.33
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 93.33
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 93.32
PRK00676338 hemA glutamyl-tRNA reductase; Validated 93.28
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 93.26
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.25
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 93.24
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 93.24
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 93.24
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.22
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 93.19
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 93.12
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 93.06
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.03
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 93.02
PRK06153 393 hypothetical protein; Provisional 93.01
COG2907 447 Predicted NAD/FAD-binding protein [General functio 92.99
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.96
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 92.95
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.94
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 92.87
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 92.86
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 92.86
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.83
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 92.82
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 92.8
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 92.79
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.76
cd01491 286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 92.72
PRK12550272 shikimate 5-dehydrogenase; Reviewed 92.72
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 92.69
KOG1276|consensus 491 92.66
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 92.64
PRK04148134 hypothetical protein; Provisional 92.62
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 92.62
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.6
PTZ00075 476 Adenosylhomocysteinase; Provisional 92.54
KOG0024|consensus354 92.53
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.43
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 92.39
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 92.37
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 92.34
PLN02494 477 adenosylhomocysteinase 92.31
PRK06057 255 short chain dehydrogenase; Provisional 92.29
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
Probab=99.94  E-value=3.3e-25  Score=190.07  Aligned_cols=174  Identities=28%  Similarity=0.386  Sum_probs=134.9

Q ss_pred             ChhhhhhC-CCCEEEEccCCCCCcccCCCCCCccCCCceehhhhHHHHhccccCCccCCCCCCCCCCCcceEEEEcCChh
Q psy16200          2 PTLKLRKD-GYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDT   80 (183)
Q Consensus         2 ~~~~l~~~-~~davviATGa~~p~~l~i~gg~~~~~~V~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~VvViGgG~~   80 (183)
                      +.+++.+. +||+||||||++.|+.|++| | .+.+||+++.+|+...+...  .++..+.  .....+++|+|||||++
T Consensus       219 ~~~~~~~~~~~d~viiAtGa~~~~~l~ip-G-~~~~gV~~~~~~l~~~~~~~--~~~~~~~--~~~~~gk~VvVIGgG~v  292 (464)
T PRK12831        219 TIDELLEEEGFDAVFIGSGAGLPKFMGIP-G-ENLNGVFSANEFLTRVNLMK--AYKPEYD--TPIKVGKKVAVVGGGNV  292 (464)
T ss_pred             CHHHHHhccCCCEEEEeCCCCCCCCCCCC-C-cCCcCcEEHHHHHHHHHhcc--ccccccc--CcccCCCeEEEECCcHH
Confidence            44555443 69999999999668999999 5 78899999999997654210  0110000  11235678999999999


Q ss_pred             HHHHHHHHHHcCCceEEEEEeecCCcCCCCHHHHHHHHHcCcEEEeCCcceEEEc-cCCcEEEEEEEEeee---cCCCCe
Q psy16200         81 AFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDV-KDNKIAGMQFNRTEQ---NEKGEW  156 (183)
Q Consensus        81 g~e~A~~l~~~G~~~V~lv~r~~~~~~~~~~~~~~~~~~~gv~~~~~~~~~~i~~-~~~~v~~v~~~~~~~---~~~~~~  156 (183)
                      |+|+|..|.++|+ +|++++|++...|+....+++.+.++||+|++++.+.++.. ++++++++++.++++   +++|+.
T Consensus       293 a~d~A~~l~r~Ga-~Vtlv~r~~~~~m~a~~~e~~~a~~eGV~i~~~~~~~~i~~~~~g~v~~v~~~~~~~~~~d~~Gr~  371 (464)
T PRK12831        293 AMDAARTALRLGA-EVHIVYRRSEEELPARVEEVHHAKEEGVIFDLLTNPVEILGDENGWVKGMKCIKMELGEPDASGRR  371 (464)
T ss_pred             HHHHHHHHHHcCC-EEEEEeecCcccCCCCHHHHHHHHHcCCEEEecccceEEEecCCCeEEEEEEEEEEecCcCCCCCc
Confidence            9999999999998 59999998876788888888888899999999999999975 457899898877654   344543


Q ss_pred             e--cCCCceEEEECCEEEEcccccccCC
Q psy16200        157 V--EDEEQRIKLKANYIISAFGSTLLDN  182 (183)
Q Consensus       157 ~--~~~g~~~~i~~D~Vi~a~G~~p~~~  182 (183)
                      .  ..+|++.+++||+||+|+|+.|++.
T Consensus       372 ~~~~~~g~~~~i~~D~Vi~AiG~~p~~~  399 (464)
T PRK12831        372 RPVEIEGSEFVLEVDTVIMSLGTSPNPL  399 (464)
T ss_pred             cceecCCceEEEECCEEEECCCCCCChh
Confidence            2  2367777899999999999999863



>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>KOG2013|consensus Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1h7x_A 1025 Dihydropyrimidine Dehydrogenase (Dpd) From Pig, Ter 3e-55
1h7w_A 1025 Dihydropyrimidine Dehydrogenase (Dpd) From Pig Leng 3e-55
2vdc_G456 The 9.5 A Resolution Structure Of Glutamate Synthas 1e-06
>pdb|1H7X|A Chain A, Dihydropyrimidine Dehydrogenase (Dpd) From Pig, Ternary Complex Of A Mutant Enzyme (C671a), Nadph And 5- Fluorouracil Length = 1025 Back     alignment and structure

Iteration: 1

Score = 210 bits (535), Expect = 3e-55, Method: Compositional matrix adjust. Identities = 107/176 (60%), Positives = 127/176 (72%), Gaps = 2/176 (1%) Query: 6 LRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATXXXXXXXXXXXXXXX 65 L+++GY A FIGIG P IFQGLT++ GFYTSK FLP VA Sbjct: 271 LKEEGYKAAFIGIGLPEPKTDDIFQGLTQDQGFYTSKDFLPLVA--KSSKAGMCACHSPL 328 Query: 66 PILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFL 125 P ++G VIVLGAGDTAFDCATSALRCGA +V +VFRKG NIRAVPEEV+LA EEKCEFL Sbjct: 329 PSIRGAVIVLGAGDTAFDCATSALRCGARRVFLVFRKGFVNIRAVPEEVELAKEEKCEFL 388 Query: 126 PFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLD 181 PF+SP +V VK +I +QF RTEQ+E G+W EDE+Q + LKA+ +ISAFGS L D Sbjct: 389 PFLSPRKVIVKGGRIVAVQFVRTEQDETGKWNEDEDQIVHLKADVVISAFGSVLRD 444
>pdb|1H7W|A Chain A, Dihydropyrimidine Dehydrogenase (Dpd) From Pig Length = 1025 Back     alignment and structure
>pdb|2VDC|G Chain G, The 9.5 A Resolution Structure Of Glutamate Synthase From Cryo-Electron Microscopy And Its Oligomerization Behavior In Solution: Functional Implications. Length = 456 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 7e-61
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 4e-13
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 1e-04
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 3e-04
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
 Score =  202 bits (515), Expect = 7e-61
 Identities = 112/174 (64%), Positives = 133/174 (76%), Gaps = 2/174 (1%)

Query: 6   LRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESL 65
           L+++GY A FIGIG P      IFQGLT++ GFYTSK FLP VA SSK G+C       L
Sbjct: 271 LKEEGYKAAFIGIGLPEPKTDDIFQGLTQDQGFYTSKDFLPLVAKSSKAGMCA--CHSPL 328

Query: 66  PILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFL 125
           P ++G VIVLGAGDTAFDCATSALRCGA +V +VFRKG  NIRAVPEEV+LA EEKCEFL
Sbjct: 329 PSIRGAVIVLGAGDTAFDCATSALRCGARRVFLVFRKGFVNIRAVPEEVELAKEEKCEFL 388

Query: 126 PFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTL 179
           PF+SP +V VK  +I  +QF RTEQ+E G+W EDE+Q + LKA+ +ISAFGS L
Sbjct: 389 PFLSPRKVIVKGGRIVAVQFVRTEQDETGKWNEDEDQIVHLKADVVISAFGSVL 442


>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.92
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.91
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.83
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 99.81
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.81
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.8
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.77
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.77
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.77
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 99.77
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 99.76
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.76
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.76
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 99.76
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.76
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.76
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.76
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.75
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.75
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.75
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.75
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 99.75
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 99.75
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.74
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.74
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 99.74
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.73
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.73
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.73
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.73
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 99.73
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 99.73
1fec_A 490 Trypanothione reductase; redox-active center, oxid 99.73
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.73
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.73
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 99.73
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.73
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.73
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 99.73
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 99.72
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.72
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.72
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.72
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.72
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.72
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.72
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.72
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.71
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.71
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.71
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.71
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.71
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.71
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.71
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 99.7
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.7
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.7
1ojt_A 482 Surface protein; redox-active center, glycolysis, 99.69
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.69
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.69
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.69
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.68
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 99.68
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.68
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.67
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.67
4dna_A 463 Probable glutathione reductase; structural genomic 99.67
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.67
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.67
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.65
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.65
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.65
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.64
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 99.64
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 99.61
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 99.59
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.59
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.53
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.53
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.48
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.47
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.46
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.4
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.39
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.36
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 99.35
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 99.29
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 99.21
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.2
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.14
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.08
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 99.0
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.95
2cul_A 232 Glucose-inhibited division protein A-related PROT 98.88
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.82
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.81
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.76
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.7
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.66
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.64
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.64
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.62
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 98.6
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.6
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.59
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.57
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.57
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.54
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.54
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.54
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 98.54
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 98.54
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.53
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.52
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.51
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.51
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.5
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 98.49
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.49
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.48
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 98.47
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 98.46
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.46
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 98.45
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 98.45
3atr_A 453 Conserved archaeal protein; saturating double bond 98.45
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.44
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.43
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.43
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 98.42
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.39
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.39
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.38
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.38
4fk1_A 304 Putative thioredoxin reductase; structural genomic 98.38
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 98.37
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.37
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 98.37
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.37
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.36
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.35
3r9u_A 315 Thioredoxin reductase; structural genomics, center 98.35
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 98.35
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.35
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.34
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.33
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.33
3dme_A 369 Conserved exported protein; structural genomics, P 98.32
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 98.3
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 98.3
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.29
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.29
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 98.28
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.28
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.27
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.26
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.26
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 98.24
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.24
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.23
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.22
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 98.21
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.21
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 98.2
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 98.17
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.16
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.16
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.14
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.14
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.14
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.13
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.12
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.11
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 98.11
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 98.1
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.09
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.09
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.09
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.08
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.07
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 98.06
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 98.05
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 98.05
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.04
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 98.04
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.03
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.02
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.02
4hb9_A 412 Similarities with probable monooxygenase; flavin, 98.01
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.01
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.99
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.98
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.98
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.97
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.96
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.96
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.95
1ojt_A 482 Surface protein; redox-active center, glycolysis, 97.95
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.94
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.93
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.93
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.92
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.92
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 97.91
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 97.9
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.89
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.88
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.87
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.87
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.86
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.86
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.85
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.85
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.83
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.81
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.8
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.77
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.76
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.76
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.76
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.74
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.74
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.73
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 97.71
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.71
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.7
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 97.68
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.67
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.65
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.64
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.63
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 97.58
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.58
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.57
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.56
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 97.56
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.54
1fec_A 490 Trypanothione reductase; redox-active center, oxid 97.53
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 97.53
4dna_A 463 Probable glutathione reductase; structural genomic 97.53
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 97.52
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 97.51
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.47
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.47
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.46
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.36
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.31
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.25
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.15
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.07
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.91
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.91
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 96.85
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 96.84
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 96.83
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 96.79
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.77
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.75
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 96.71
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 96.63
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.62
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.59
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.57
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 96.56
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 96.52
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.49
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.46
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.45
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 96.42
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 96.4
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.38
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 96.36
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 96.33
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.29
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 96.26
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.26
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 96.26
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 96.25
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.2
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 96.18
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.18
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.18
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 96.14
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 96.12
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 96.11
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.1
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.07
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 96.06
3fpz_A 326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 96.01
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.0
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 95.94
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 95.92
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 95.9
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.88
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 95.87
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 95.84
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 95.72
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 95.65
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.6
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 95.56
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 95.49
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.48
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 95.47
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.35
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 95.21
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 95.08
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 94.99
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 94.93
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 94.81
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 94.81
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.71
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.71
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 94.65
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 94.62
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.62
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 94.6
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 94.53
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 94.47
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 94.43
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 94.42
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.42
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.39
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 94.36
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 94.34
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 94.31
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.3
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 94.27
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.25
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 94.2
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 94.18
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 94.18
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 94.16
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 94.13
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 94.11
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 94.1
3p2o_A285 Bifunctional protein fold; structural genomics, ce 94.1
3l07_A285 Bifunctional protein fold; structural genomics, ID 94.09
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 94.06
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 94.01
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 94.0
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 93.98
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 93.96
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 93.95
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 93.91
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 93.89
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 93.89
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 93.87
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 93.87
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 93.7
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 93.69
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 93.68
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.67
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 93.67
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 93.67
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 93.6
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 93.57
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 93.54
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 93.5
2rir_A300 Dipicolinate synthase, A chain; structural genomic 93.47
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 93.46
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 93.46
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 93.4
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 93.39
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.38
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 93.37
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 93.36
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 93.36
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.34
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 93.31
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 93.27
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 93.24
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 93.21
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 93.16
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 93.15
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 93.13
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 93.12
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 93.09
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 93.07
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 93.04
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 93.03
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 93.03
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 93.03
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 93.01
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 92.97
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 92.95
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 92.94
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 92.94
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 92.91
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 92.88
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 92.86
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 92.75
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 92.72
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 92.68
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 92.57
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 92.55
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 92.46
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 92.46
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 92.45
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 92.45
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 92.44
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 92.42
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 92.4
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 92.33
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 92.31
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 92.3
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 92.29
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 92.25
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 92.25
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 92.24
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 92.23
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 92.19
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 92.18
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.09
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 92.06
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 92.04
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 92.0
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 92.0
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 91.99
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 91.97
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 91.96
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 91.93
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 91.92
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 91.91
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 91.89
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 91.88
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 91.86
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 91.84
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 91.8
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 91.79
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 91.76
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 91.72
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 91.71
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 91.69
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.67
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 91.64
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 91.59
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 91.58
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 91.56
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 91.54
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 91.54
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 91.51
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 91.41
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 91.41
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 91.37
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 91.36
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 91.35
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 91.35
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 91.34
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 91.32
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 91.32
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 91.29
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 91.24
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 91.24
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.21
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 91.21
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 91.2
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 91.17
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 91.08
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 91.08
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 91.02
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 91.0
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 90.99
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 90.99
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 90.98
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 90.95
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 90.88
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 90.84
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 90.84
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 90.84
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 90.8
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 90.8
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 90.74
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 90.73
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 90.7
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 90.69
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 90.65
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 90.64
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 90.6
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 90.57
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 90.55
4ezb_A 317 Uncharacterized conserved protein; structural geno 90.52
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 90.52
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 90.47
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 90.46
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 90.45
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 90.43
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 90.43
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 90.4
3tl2_A 315 Malate dehydrogenase; center for structural genomi 90.36
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 90.33
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 90.32
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 90.32
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 90.31
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 90.31
3qha_A 296 Putative oxidoreductase; seattle structural genomi 90.27
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 90.26
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 90.26
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 90.25
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 90.24
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 90.24
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
Probab=99.92  E-value=5.6e-24  Score=195.97  Aligned_cols=177  Identities=64%  Similarity=1.055  Sum_probs=137.5

Q ss_pred             ChhhhhhCCCCEEEEccCCCCCcccCCCCCCccCCCceehhhhHHHHhccccCCccCCCCCCCCCCCcceEEEEcCChhH
Q psy16200          2 PTLKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTA   81 (183)
Q Consensus         2 ~~~~l~~~~~davviATGa~~p~~l~i~gg~~~~~~V~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~VvViGgG~~g   81 (183)
                      +++++.+..||+||||||++.|+.+++++|+.+.++|+++.+||...++..+.++| .++. ..+..+++|+|||||++|
T Consensus       267 ~~~~~~~~~~d~vvlAtGa~~p~~l~~~~G~~~~~gv~~a~~~L~~~~~~~~~~~~-~~~~-~~~~~~~~VvVIGgG~~g  344 (1025)
T 1gte_A          267 TLNTLKEEGYKAAFIGIGLPEPKTDDIFQGLTQDQGFYTSKDFLPLVAKSSKAGMC-ACHS-PLPSIRGAVIVLGAGDTA  344 (1025)
T ss_dssp             CHHHHHHTTCCEEEECCCCCEECCCGGGTTCCTTTTEEEHHHHHHHHHHHHCBTTB-SCCC-CCCCCCSEEEEECSSHHH
T ss_pred             EhhhcCccCCCEEEEecCCCCCCCCCCCCCCCCCCCEEEhHHHHHHHHhhcccccc-cccc-cccccCCcEEEECCChHH
Confidence            45666677899999999985587777642544457899999999865442121111 1111 123456789999999999


Q ss_pred             HHHHHHHHHcCCceEEEEEeecCCcCCCCHHHHHHHHHcCcEEEeCCcceEEEccCCcEEEEEEEEeeecCCCCeecCCC
Q psy16200         82 FDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEE  161 (183)
Q Consensus        82 ~e~A~~l~~~G~~~V~lv~r~~~~~~~~~~~~~~~~~~~gv~~~~~~~~~~i~~~~~~v~~v~~~~~~~~~~~~~~~~~g  161 (183)
                      +|+|..+.++|+++|++++|++...++..+.++..+.++||+|+++..+.++..++++++++++.+++.+++|++...+|
T Consensus       345 ~e~A~~~~~~G~~~Vtvv~r~~~~~~~~~~~e~~~~~~~Gv~~~~~~~~~~i~~~~g~v~~v~~~~~~~~~~g~~~~~~g  424 (1025)
T 1gte_A          345 FDCATSALRCGARRVFLVFRKGFVNIRAVPEEVELAKEEKCEFLPFLSPRKVIVKGGRIVAVQFVRTEQDETGKWNEDED  424 (1025)
T ss_dssp             HHHHHHHHHTTCSEEEEECSSCGGGCCSCHHHHHHHHHTTCEEECSEEEEEEEEETTEEEEEEEEEEEECTTSCEEEEEE
T ss_pred             HHHHHHHHHcCCCEEEEEEecChhhCCCCHHHHHHHHHcCCEEEeCCCceEEEccCCeEEEEEEEEeEEcCCCCcccCCC
Confidence            99999999999868999999886668888888888899999999999999998666788888887776667776655566


Q ss_pred             ceEEEECCEEEEccccccc
Q psy16200        162 QRIKLKANYIISAFGSTLL  180 (183)
Q Consensus       162 ~~~~i~~D~Vi~a~G~~p~  180 (183)
                      ++.++++|+||+|+|++|+
T Consensus       425 ~~~~i~aD~Vi~A~G~~~~  443 (1025)
T 1gte_A          425 QIVHLKADVVISAFGSVLR  443 (1025)
T ss_dssp             EEEEEECSEEEECSCEECC
T ss_pred             ceEEEECCEEEECCCCCCC
Confidence            6778999999999999875



>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 6e-37
d1ps9a2162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 4e-05
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 6e-05
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 7e-04
d1lqta1216 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA 0.003
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: C-terminal domain of adrenodoxin reductase-like
domain: Dihydropyrimidine dehydrogenase, domain 3
species: Pig (Sus scrofa) [TaxId: 9823]
 Score =  123 bits (309), Expect = 6e-37
 Identities = 101/154 (65%), Positives = 119/154 (77%), Gaps = 2/154 (1%)

Query: 24  NVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFD 83
               IFQGLT++ GFYTSK FLP VA SSK G+C       LP ++G VIVLGAGDTAFD
Sbjct: 2   KTDDIFQGLTQDQGFYTSKDFLPLVAKSSKAGMCACHSP--LPSIRGAVIVLGAGDTAFD 59

Query: 84  CATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGM 143
           CATSALRCGA +V +VFRKG  NIRAVPEEV+LA EEKCEFLPF+SP +V VK  +I  +
Sbjct: 60  CATSALRCGARRVFLVFRKGFVNIRAVPEEVELAKEEKCEFLPFLSPRKVIVKGGRIVAV 119

Query: 144 QFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGS 177
           QF RTEQ+E G+W EDE+Q + LKA+ +ISAFGS
Sbjct: 120 QFVRTEQDETGKWNEDEDQIVHLKADVVISAFGS 153


>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 216 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 99.94
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 99.88
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.86
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.82
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.8
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.78
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.78
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.78
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.78
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.76
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.75
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.74
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.74
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.73
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.71
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.7
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.69
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.69
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.67
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.67
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.66
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.66
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.66
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.65
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.65
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.48
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.29
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.16
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.07
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.07
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.0
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.87
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.84
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.83
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.83
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.77
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.75
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.7
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.67
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.64
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 98.6
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.58
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.51
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 98.5
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 98.5
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.48
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.48
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.47
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.41
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.41
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.41
d2cula1 230 GidA-related protein TTHA1897 {Thermus thermophilu 98.36
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.32
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 98.3
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.29
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.27
d1xdia1 233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.25
d1mo9a1 261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.24
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.23
d1kf6a2 311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.19
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.0
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 98.0
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.98
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.94
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.85
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.85
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.79
d1h6va1 235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.75
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 97.72
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.71
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.65
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.61
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.6
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.59
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.55
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.53
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.49
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.48
d1chua2 305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.48
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.46
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.36
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.31
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.29
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.23
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 97.21
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.2
d1ebda1 223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.19
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.13
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.1
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.09
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.08
d3grsa1 221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.03
d3lada1 229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.02
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 96.94
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.9
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.76
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.67
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.62
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 96.57
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.48
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.45
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 96.23
d1feca1 240 Trypanothione reductase {Crithidia fasciculata [Ta 96.23
d1aoga1 238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.22
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.15
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 96.11
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 96.1
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 96.07
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 95.95
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.94
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.87
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.84
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 95.82
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 95.8
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.64
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.63
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.55
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 95.54
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.36
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 95.32
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.31
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 95.3
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 95.14
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.08
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.97
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.93
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.93
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 94.81
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.77
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.67
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.65
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 94.57
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 94.57
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 94.55
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.54
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.53
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.53
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.46
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.42
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.36
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 94.35
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.28
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.24
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.15
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.15
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.13
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.11
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.03
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.99
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.95
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 93.93
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 93.82
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.82
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 93.76
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 93.7
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 93.68
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.68
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 93.58
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 93.3
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.2
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 93.16
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 93.01
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 92.96
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.89
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.82
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 92.81
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 92.75
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.73
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.67
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 92.65
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 92.58
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.57
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 92.49
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 92.48
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.43
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.41
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.36
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.35
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 92.26
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 92.24
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 92.2
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 92.19
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.05
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 92.03
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 92.02
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 92.02
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 92.01
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 92.0
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 91.98
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 91.95
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 91.94
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 91.93
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 91.87
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.86
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 91.84
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 91.83
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.81
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 91.77
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 91.75
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 91.68
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 91.67
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 91.67
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 91.63
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 91.63
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 91.55
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 91.52
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 91.49
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 91.47
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 91.36
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 91.34
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 91.34
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 91.32
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.27
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 91.26
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 91.17
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 91.16
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 91.11
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 91.09
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 91.08
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 91.05
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 91.04
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 90.97
d1ju2a1 351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 90.94
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.93
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 90.88
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 90.81
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 90.79
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 90.79
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 90.75
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.75
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 90.73
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 90.64
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 90.63
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.56
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.44
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.4
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 90.4
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 90.37
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 90.36
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 90.34
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 90.31
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 90.31
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 90.24
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 90.09
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 89.99
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 89.99
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 89.84
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 89.68
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 89.57
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 89.54
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 89.53
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 89.52
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 89.47
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 89.34
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.96
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 88.84
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.84
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.71
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 88.68
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 88.65
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 88.64
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 88.54
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 88.49
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 87.99
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 87.87
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 87.28
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 87.21
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 86.99
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 86.82
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 86.75
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 86.21
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 85.5
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 85.44
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 85.33
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 85.32
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 85.18
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 85.09
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 85.07
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 85.03
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 84.99
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 84.93
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 84.89
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 84.5
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 84.43
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 84.37
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 84.11
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 83.79
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.75
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 83.71
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 83.62
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 83.57
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 83.35
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 83.13
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 83.06
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 82.59
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 82.55
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 82.39
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 82.01
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 81.42
d2bd0a1 240 Bacterial sepiapterin reductase {Chlorobium tepidu 81.4
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 80.28
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: C-terminal domain of adrenodoxin reductase-like
domain: Dihydropyrimidine dehydrogenase, domain 3
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.94  E-value=3.4e-26  Score=166.37  Aligned_cols=145  Identities=68%  Similarity=1.093  Sum_probs=125.8

Q ss_pred             CCccCCCceehhhhHHHHhccccCCccCCCCCCCCCCCcceEEEEcCChhHHHHHHHHHHcCCceEEEEEeecCCcCCCC
Q psy16200         31 GLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAV  110 (183)
Q Consensus        31 g~~~~~~V~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~VvViGgG~~g~e~A~~l~~~G~~~V~lv~r~~~~~~~~~  110 (183)
                      |+...+|+|++.+||...+...+.++|..+.  .++..++||+|||||++|+|+|.++.++|+++|++++|++...+++.
T Consensus         9 g~~~~~G~~~a~dfL~~~~~~~~~~~~~~~~--~~p~~~~kVvVIGGGdtA~D~A~~a~r~GA~~V~vi~rr~~~~~~a~   86 (153)
T d1gtea3           9 GLTQDQGFYTSKDFLPLVAKSSKAGMCACHS--PLPSIRGAVIVLGAGDTAFDCATSALRCGARRVFLVFRKGFVNIRAV   86 (153)
T ss_dssp             TCCTTTTEEEHHHHHHHHHHHHCBTTBSCCC--CCCCCCSEEEEECSSHHHHHHHHHHHHTTCSEEEEECSSCGGGCCSC
T ss_pred             CCcccCCEEEHHHHHHHHHhccccCCCcccC--ccccCCCEEEEECCChhHHHHHHHHHHcCCcceeEEEeCChhhhccc
Confidence            5556679999999998877766667775433  45667788999999999999999999999999999999988778888


Q ss_pred             HHHHHHHHHcCcEEEeCCcceEEEccCCcEEEEEEEEeeecCCCCeecCCCceEEEECCEEEEcccc
Q psy16200        111 PEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGS  177 (183)
Q Consensus       111 ~~~~~~~~~~gv~~~~~~~~~~i~~~~~~v~~v~~~~~~~~~~~~~~~~~g~~~~i~~D~Vi~a~G~  177 (183)
                      ..++..+..+++.++++..+.++..+++++.++++.+++++++|++...+|++++|+||.||+|+|.
T Consensus        87 ~~~~~~a~~~~~~~~~~~~~~ei~~~~~~~~~v~~~~~e~d~~G~~~~~~g~e~~i~aD~V~~AiG~  153 (153)
T d1gtea3          87 PEEVELAKEEKCEFLPFLSPRKVIVKGGRIVAVQFVRTEQDETGKWNEDEDQIVHLKADVVISAFGS  153 (153)
T ss_dssp             HHHHHHHHHTTCEEECSEEEEEEEEETTEEEEEEEEEEEECTTSCEEEEEEEEEEEECSEEEECSCE
T ss_pred             hhheeecccccceeEeccccEEEEecCCceEEEEEEEeeECCCCCEecCCCCEEEEECCEEEECcCc
Confidence            8888888999999999999999987778888888888888889998878899999999999999993



>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure