Diaphorina citri psyllid: psy16208


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MFSVMDTLQKDEDETDNPELGIDNVGGVFVVLIAGCGVSFLFSLLEFLWNVRKVAVEEKLSPYEAFMLELKFAIRCYGTSKPVRRKASTPSLKSNSLANLDLFNNKMNMINYNSTR
cccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHcccccccccccccccccccccccccccccccccccccccc
*F*****************LGIDNVGGVFVVLIAGCGVSFLFSLLEFLWNVRKVAVEEKLSPYEAFMLELKFAIRCYGT*************************************
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSVMDTLQKDEDETDNPELGIDNVGGVFVVLIAGCGVSFLFSLLEFLWNVRKVAVEEKLSPYEAFMLELKFAIRCYGTSKPVRRKASTPSLKSNSLANLDLFNNKMNMINYNSTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0008328 [CC]ionotropic glutamate receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0034613 [BP]cellular protein localizationprobableGO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0043197 [CC]dendritic spineprobableGO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0015277 [MF]kainate selective glutamate receptor activityprobableGO:0038023, GO:0060089, GO:0008066, GO:0003674, GO:0004872, GO:0004871, GO:0004970, GO:0015276, GO:0022803, GO:0005216, GO:0005215, GO:0005230, GO:0022891, GO:0022892, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838, GO:0004888
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KG2, chain A
Confidence level:confident
Coverage over the Query: 5-50
View the alignment between query and template
View the model in PyMOL