Psyllid ID: psy16220


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MPEQVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAASRLTEDILPPGSYPVKGFDPPVSFNR
ccccccccccEEEEEccccHHHHHHHHHHHHccccEEEcccccccccccccHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHcccccHHcHHcHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccccccccccccccccccccccccccccccc
cHHHHcccccEEEEcccccHHHHHHHHHHHHcccEEEEEEcccHHHHccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHccccEEEEcccccccEccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccEEEEEEccHHHccEcccEHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEccEcccccccccHHcccccccccHHHHcc
mpeqvrfdGRVAIVTGAGAGLGRSYALLLAERGASVvvndlggqrdgdgksskAADTVVAEIRSkggkavpnynsvvdGDKIVQTALEnfgridivinnagilrdksfarisdtdwqlVQDVHLTGafrvsraawphmkkqnyGRLVMtasnsgllgnfgqaNYSAAKMALVGLSNtlsiegeknnihcnvivptaasrltedilppgsypvkgfdppvsfnr
mpeqvrfdgrvaiVTGAGAGLGRSYALLLAERGASVVVNdlggqrdgdgksskaADTVVAEirskggkavpnynsvvDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAfrvsraawphmKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAASRLTEDILPpgsypvkgfdppvsfnr
MPEQVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAASRLTEDILPPGSYPVKGFDPPVSFNR
******FDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDL**************************KAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAASRLTEDIL******************
***QVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDG****SKAADTVVAEIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAASRLTEDILPP*S*****FDPPVSFN*
MPEQVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQ************TVVAEIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAASRLTEDILPPGSYPVKGFDPPVSFNR
*****RFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRD*D*KSSKAADTVVAEIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAASRLTEDILPPGSYPVKGFDPP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPEQVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAASRLTEDILPPGSYPVKGFDPPVSFNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
P97852 735 Peroxisomal multifunction yes N/A 0.923 0.280 0.694 8e-82
P51660 735 Peroxisomal multifunction yes N/A 0.923 0.280 0.689 1e-81
Q9VXJ0 598 Peroxisomal multifunction yes N/A 0.910 0.339 0.674 2e-81
P51659 736 Peroxisomal multifunction yes N/A 0.923 0.279 0.674 6e-80
Q9NKW1 441 Peroxisomal multifunction yes N/A 0.910 0.460 0.635 9e-74
Q02207 900 Peroxisomal hydratase-deh yes N/A 0.928 0.23 0.596 3e-67
P22414 906 Peroxisomal hydratase-deh N/A N/A 0.856 0.210 0.591 8e-65
P96825286 Putative short-chain type yes N/A 0.887 0.692 0.606 8e-65
Q01373 894 Peroxisomal hydratase-deh N/A N/A 0.869 0.217 0.608 1e-64
P73574247 3-oxoacyl-[acyl-carrier-p N/A N/A 0.896 0.809 0.395 5e-32
>sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 Back     alignment and function desciption
 Score =  303 bits (775), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 170/206 (82%)

Query: 1   MPEQVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVA 60
           M   +RFDGRV +VTGAG GLGR+YAL  AERGA VVVNDLGG   G GK S AAD VV 
Sbjct: 1   MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVE 60

Query: 61  EIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQ 120
           EIR +GGKAV NY+SV  G+K+V+TAL+ FGRID+V+NNAGILRD+SF+RISD DW ++Q
Sbjct: 61  EIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQ 120

Query: 121 DVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSI 180
            VHL G+F+V+RAAW HMKKQNYGR++MTAS SG+ GNFGQANYSAAK+ L+GL+NTL I
Sbjct: 121 RVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVI 180

Query: 181 EGEKNNIHCNVIVPTAASRLTEDILP 206
           EG KNNIHCN I P A SR+TE ++P
Sbjct: 181 EGRKNNIHCNTIAPNAGSRMTETVMP 206




Bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. Catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids.
Rattus norvegicus (taxid: 10116)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1EC: 9
>sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 Back     alignment and function description
>sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 Back     alignment and function description
>sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 Back     alignment and function description
>sp|Q9NKW1|MFEA_DICDI Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1 Back     alignment and function description
>sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=1 SV=1 Back     alignment and function description
>sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 Back     alignment and function description
>sp|P96825|Y0148_MYCTU Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis GN=Rv0148 PE=1 SV=3 Back     alignment and function description
>sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 Back     alignment and function description
>sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
328711508 721 PREDICTED: peroxisomal multifunctional e 0.932 0.288 0.812 4e-91
328711512 596 PREDICTED: peroxisomal multifunctional e 0.932 0.348 0.812 4e-91
350401830 727 PREDICTED: peroxisomal multifunctional e 0.923 0.283 0.747 7e-88
156554853 722 PREDICTED: peroxisomal multifunctional e 0.919 0.283 0.760 1e-87
340718384 724 PREDICTED: LOW QUALITY PROTEIN: peroxiso 0.919 0.283 0.746 1e-86
390334812 743 PREDICTED: peroxisomal multifunctional e 0.928 0.278 0.763 2e-86
91085817 715 PREDICTED: similar to estradiol 17 beta- 0.923 0.288 0.742 4e-86
383861721 727 PREDICTED: peroxisomal multifunctional e 0.919 0.281 0.731 6e-86
158293426 724 AGAP008667-PA [Anopheles gambiae str. PE 0.910 0.280 0.75 5e-85
328792111 727 PREDICTED: peroxisomal multifunctional e 0.932 0.286 0.706 5e-85
>gi|328711508|ref|XP_003244558.1| PREDICTED: peroxisomal multifunctional enzyme type 2-like isoform 2 [Acyrthosiphon pisum] gi|328711510|ref|XP_003244559.1| PREDICTED: peroxisomal multifunctional enzyme type 2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 193/208 (92%)

Query: 3   EQVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEI 62
           +++RFDGRVAIVTGAGAGLG++YALL AERGASVVVNDLGG R GDG SSKAAD+VV EI
Sbjct: 2   DKLRFDGRVAIVTGAGAGLGKAYALLFAERGASVVVNDLGGSRSGDGSSSKAADSVVTEI 61

Query: 63  RSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDV 122
           RSKGGKAVPNY+SVVDGDK+VQTALENFGRIDIV+NNAGILRDKSFARIS++DW LV DV
Sbjct: 62  RSKGGKAVPNYDSVVDGDKLVQTALENFGRIDIVVNNAGILRDKSFARISESDWNLVHDV 121

Query: 123 HLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEG 182
           HL GAF+V++AAWPH +KQNYGR+++T+SNSGL GNFGQANYSAAK+ LVGL NT++IEG
Sbjct: 122 HLKGAFKVTQAAWPHFRKQNYGRVIVTSSNSGLYGNFGQANYSAAKLGLVGLCNTMAIEG 181

Query: 183 EKNNIHCNVIVPTAASRLTEDILPPGSY 210
            KNNI+CNVIVPTAASRLTEDILPP  +
Sbjct: 182 RKNNINCNVIVPTAASRLTEDILPPDFF 209




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328711512|ref|XP_001947608.2| PREDICTED: peroxisomal multifunctional enzyme type 2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350401830|ref|XP_003486274.1| PREDICTED: peroxisomal multifunctional enzyme type 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156554853|ref|XP_001606624.1| PREDICTED: peroxisomal multifunctional enzyme type 2-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340718384|ref|XP_003397648.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal multifunctional enzyme type 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|390334812|ref|XP_786662.3| PREDICTED: peroxisomal multifunctional enzyme type 2 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|91085817|ref|XP_974784.1| PREDICTED: similar to estradiol 17 beta-dehydrogenase [Tribolium castaneum] gi|270011047|gb|EFA07495.1| hydroxysteroid (17-beta) dehydrogenase 4 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383861721|ref|XP_003706333.1| PREDICTED: peroxisomal multifunctional enzyme type 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|158293426|ref|XP_314766.4| AGAP008667-PA [Anopheles gambiae str. PEST] gi|157016700|gb|EAA10131.4| AGAP008667-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328792111|ref|XP_393475.3| PREDICTED: peroxisomal multifunctional enzyme type 2-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
RGD|621806 735 Hsd17b4 "hydroxysteroid (17-be 0.923 0.280 0.694 1.3e-75
UNIPROTKB|Q6IN39 751 Hsd17b4 "Hsd17b4 protein" [Rat 0.923 0.274 0.694 1.3e-75
MGI|MGI:105089 735 Hsd17b4 "hydroxysteroid (17-be 0.923 0.280 0.689 2.1e-75
FB|FBgn0030731 598 Mfe2 "peroxisomal Multifunctio 0.910 0.339 0.674 1.2e-74
ZFIN|ZDB-GENE-040421-1 725 hsd17b4 "hydroxysteroid (17-be 0.928 0.285 0.671 1.5e-74
UNIPROTKB|Q0IIL6 736 HSD17B4 "Uncharacterized prote 0.923 0.279 0.699 1.9e-74
UNIPROTKB|E1BW32 624 HSD17B4 "Uncharacterized prote 0.923 0.330 0.685 6.5e-74
UNIPROTKB|F1NKH9 678 HSD17B4 "Uncharacterized prote 0.923 0.303 0.685 6.5e-74
UNIPROTKB|E7ER27 500 HSD17B4 "(3R)-hydroxyacyl-CoA 0.923 0.412 0.674 6.5e-74
UNIPROTKB|P51659 736 HSD17B4 "Peroxisomal multifunc 0.923 0.279 0.674 6.5e-74
RGD|621806 Hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 762 (273.3 bits), Expect = 1.3e-75, P = 1.3e-75
 Identities = 143/206 (69%), Positives = 170/206 (82%)

Query:     1 MPEQVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVA 60
             M   +RFDGRV +VTGAG GLGR+YAL  AERGA VVVNDLGG   G GK S AAD VV 
Sbjct:     1 MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVE 60

Query:    61 EIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQ 120
             EIR +GGKAV NY+SV  G+K+V+TAL+ FGRID+V+NNAGILRD+SF+RISD DW ++Q
Sbjct:    61 EIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQ 120

Query:   121 DVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSI 180
              VHL G+F+V+RAAW HMKKQNYGR++MTAS SG+ GNFGQANYSAAK+ L+GL+NTL I
Sbjct:   121 RVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVI 180

Query:   181 EGEKNNIHCNVIVPTAASRLTEDILP 206
             EG KNNIHCN I P A SR+TE ++P
Sbjct:   181 EGRKNNIHCNTIAPNAGSRMTETVMP 206




GO:0000038 "very long-chain fatty acid metabolic process" evidence=IEA;ISO
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003857 "3-hydroxyacyl-CoA dehydrogenase activity" evidence=ISO
GO:0005102 "receptor binding" evidence=ISO
GO:0005739 "mitochondrion" evidence=IEA;ISO
GO:0005777 "peroxisome" evidence=ISO;IDA
GO:0005778 "peroxisomal membrane" evidence=ISO
GO:0006635 "fatty acid beta-oxidation" evidence=IEA;ISO
GO:0008203 "cholesterol metabolic process" evidence=NAS
GO:0008209 "androgen metabolic process" evidence=ISO
GO:0008210 "estrogen metabolic process" evidence=ISO
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016508 "long-chain-enoyl-CoA hydratase activity" evidence=ISO
GO:0016853 "isomerase activity" evidence=IEA
GO:0030283 "testosterone dehydrogenase [NAD(P)
GO:0032934 "sterol binding" evidence=IEA
GO:0033989 "3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase activity" evidence=IEA
GO:0036111 "very long-chain fatty-acyl-CoA metabolic process" evidence=ISO
GO:0036112 "medium-chain fatty-acyl-CoA metabolic process" evidence=ISO
GO:0042803 "protein homodimerization activity" evidence=ISO
GO:0043231 "intracellular membrane-bounded organelle" evidence=ISO
GO:0044594 "17-beta-hydroxysteroid dehydrogenase (NAD+) activity" evidence=ISO
GO:0060009 "Sertoli cell development" evidence=IEA;ISO
UNIPROTKB|Q6IN39 Hsd17b4 "Hsd17b4 protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:105089 Hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0030731 Mfe2 "peroxisomal Multifunctional enzyme type 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040421-1 hsd17b4 "hydroxysteroid (17-beta) dehydrogenase 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IIL6 HSD17B4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW32 HSD17B4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKH9 HSD17B4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E7ER27 HSD17B4 "(3R)-hydroxyacyl-CoA dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P51659 HSD17B4 "Peroxisomal multifunctional enzyme type 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51660DHB4_MOUSE4, ., 2, ., 1, ., 1, 1, 90.68930.92370.2802yesN/A
O67610FABG_AQUAE1, ., 1, ., 1, ., 1, 0, 00.35380.81610.7338yesN/A
Q9X248FABG_THEMA1, ., 1, ., 1, ., 1, 0, 00.36260.81160.7357yesN/A
P0A0H9FABG_STAAM1, ., 1, ., 1, ., 1, 0, 00.36700.79370.7195yesN/A
Q5HPW0FABG_STAEQ1, ., 1, ., 1, ., 1, 0, 00.36170.79370.7254yesN/A
P55541Y4LA_RHISN1, ., -, ., -, ., -0.32650.80710.6474yesN/A
Q5HGK2FABG_STAAC1, ., 1, ., 1, ., 1, 0, 00.36700.79370.7195yesN/A
Q02207FOX2_YEAST1, ., 1, ., 1, ., n, 1, 20.59610.92820.23yesN/A
Q89AG9FABG_BUCBP1, ., 1, ., 1, ., 1, 0, 00.32970.78020.7102yesN/A
Q8CPI3FABG_STAES1, ., 1, ., 1, ., 1, 0, 00.36170.79370.7254yesN/A
Q9KQH7FABG_VIBCH1, ., 1, ., 1, ., 1, 0, 00.32970.80260.7336yesN/A
Q6GHK4FABG_STAAR1, ., 1, ., 1, ., 1, 0, 00.36700.79370.7195yesN/A
P99093FABG_STAAN1, ., 1, ., 1, ., 1, 0, 00.36700.79370.7195yesN/A
Q9NKW1MFEA_DICDI1, ., 1, ., 1, ., 3, 50.63540.91030.4603yesN/A
P0A0I0FABG_STAAW1, ., 1, ., 1, ., 1, 0, 00.36700.79370.7195yesN/A
P51659DHB4_HUMAN4, ., 2, ., 1, ., 1, 1, 90.67470.92370.2798yesN/A
P0A2C9FABG_SALTY1, ., 1, ., 1, ., 1, 0, 00.34570.80260.7336yesN/A
Q6G9Y2FABG_STAAS1, ., 1, ., 1, ., 1, 0, 00.36700.79370.7195yesN/A
P55336FABG_VIBHA1, ., 1, ., 1, ., 1, 0, 00.32800.79820.7295yesN/A
P96825Y0148_MYCTU1, ., 1, ., 1, ., -0.60690.88780.6923yesN/A
Q9VXJ0DHB4_DROME4, ., 2, ., 1, ., 1, 1, 90.67480.91030.3394yesN/A
Q8K9J5FABG_BUCAP1, ., 1, ., 1, ., 1, 0, 00.31600.79820.7295yesN/A
P51831FABG_BACSU1, ., 1, ., 1, ., 1, 0, 00.39260.80710.7317yesN/A
P97852DHB4_RAT4, ., 2, ., 1, ., 1, 1, 90.69410.92370.2802yesN/A
P43713FABG_HAEIN1, ., 1, ., 1, ., 1, 0, 00.36810.82060.7561yesN/A
P0AEK3FABG_SHIFL1, ., 1, ., 1, ., 1, 0, 00.35100.80260.7336yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.766
4th Layer1.1.1.n12LOW CONFIDENCE prediction!
3rd Layer4.2.1LOW CONFIDENCE prediction!
4th Layer4.2.1.119LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 1e-126
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Pro 1e-61
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-57
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-57
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 8e-56
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-54
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 1e-52
cd05233234 cd05233, SDR_c, classical (c) SDRs 4e-51
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-48
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 6e-46
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-45
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 3e-45
COG1028251 COG1028, FabG, Dehydrogenases with different speci 7e-43
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 5e-40
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 9e-39
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 2e-38
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 2e-38
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 9e-36
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 1e-35
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-35
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 4e-35
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 8e-35
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 1e-34
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 7e-34
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 1e-33
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 1e-33
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 2e-33
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 3e-33
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 3e-33
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 7e-33
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 1e-32
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 1e-32
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 2e-32
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 2e-32
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 2e-32
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 3e-32
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 1e-31
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-31
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 4e-31
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 1e-30
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 1e-30
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 3e-30
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 3e-30
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 7e-30
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 9e-30
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 9e-30
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 1e-29
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-29
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 3e-29
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 4e-29
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 5e-29
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 6e-29
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 2e-28
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 2e-28
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 2e-28
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-28
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 3e-28
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 3e-28
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 3e-28
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 9e-28
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Pro 2e-27
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 3e-27
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 3e-27
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 4e-27
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 6e-27
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 6e-27
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 8e-27
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 1e-26
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 1e-26
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 2e-26
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 3e-26
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 3e-26
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 4e-26
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 6e-26
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 6e-26
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 7e-26
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 7e-26
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 8e-26
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 9e-26
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 1e-25
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 4e-25
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 6e-25
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 6e-25
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 6e-25
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 7e-25
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 8e-25
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 9e-25
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-24
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Pro 1e-24
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 2e-24
PRK07109 334 PRK07109, PRK07109, short chain dehydrogenase; Pro 3e-24
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 3e-24
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 4e-24
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 7e-24
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 2e-23
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote 2e-23
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 4e-23
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 5e-23
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 6e-23
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 2e-22
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 2e-22
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Pro 3e-22
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 4e-22
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 4e-22
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 5e-22
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro 6e-22
PRK08278273 PRK08278, PRK08278, short chain dehydrogenase; Pro 7e-22
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 1e-21
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 2e-21
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 2e-21
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 6e-21
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 7e-21
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 9e-21
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 1e-20
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 1e-20
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 2e-20
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 2e-20
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 2e-20
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 2e-20
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 3e-20
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 3e-20
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Val 3e-20
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 4e-20
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 5e-20
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 7e-20
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-20
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 8e-20
cd05322257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 8e-20
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 8e-20
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Pro 8e-20
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 1e-19
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 2e-19
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Pro 2e-19
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-19
cd09763265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 2e-19
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 2e-19
cd08935271 cd08935, mannonate_red_SDR_c, putative D-mannonate 3e-19
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Pro 9e-19
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 1e-18
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 1e-18
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-18
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 2e-18
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 3e-18
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 3e-18
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 4e-18
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 4e-18
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 5e-18
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 5e-18
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 5e-18
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 6e-18
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 8e-18
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 1e-17
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 2e-17
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2e-17
PRK07775274 PRK07775, PRK07775, short chain dehydrogenase; Pro 3e-17
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 5e-17
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 7e-17
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 8e-17
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 8e-17
cd09761242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 1e-16
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 1e-16
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 1e-16
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 2e-16
pfam08659181 pfam08659, KR, KR domain 2e-16
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 7e-16
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 1e-15
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidor 1e-15
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 1e-15
cd05363254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 3e-15
smart00822180 smart00822, PKS_KR, This enzymatic domain is part 4e-15
PRK06720169 PRK06720, PRK06720, hypothetical protein; Provisio 4e-15
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 5e-15
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 6e-15
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 9e-15
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Pro 1e-14
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 2e-14
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 3e-14
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 3e-14
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 7e-14
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Pro 2e-13
PRK06139 330 PRK06139, PRK06139, short chain dehydrogenase; Pro 2e-13
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 2e-13
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Pro 2e-13
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Pro 3e-13
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 4e-13
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 5e-13
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 6e-13
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 9e-13
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 9e-13
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 1e-12
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 1e-12
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 1e-12
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Pro 1e-12
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 2e-12
PRK07806248 PRK07806, PRK07806, short chain dehydrogenase; Pro 3e-12
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Pro 5e-12
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 2e-11
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 3e-11
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 4e-11
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Pro 4e-11
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 1e-10
cd08955376 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase ( 1e-10
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Pro 1e-10
cd05367241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 2e-10
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Pro 3e-10
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 3e-10
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 4e-10
cd11730206 cd11730, Tthb094_like_SDR_c, Tthb094 and related p 5e-10
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 7e-10
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 1e-09
PRK06197306 PRK06197, PRK06197, short chain dehydrogenase; Pro 1e-09
cd05274375 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatt 4e-09
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 6e-09
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Pro 1e-08
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Pro 2e-08
cd05361242 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de 2e-08
cd09807274 cd09807, retinol-DH_like_SDR_c, retinol dehydrogen 4e-08
PRK05993277 PRK05993, PRK05993, short chain dehydrogenase; Pro 5e-08
PRK09186256 PRK09186, PRK09186, flagellin modification protein 1e-07
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Pro 2e-07
PLN02780320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 3e-07
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 1e-06
PRK08339263 PRK08339, PRK08339, short chain dehydrogenase; Pro 1e-06
PRK08703239 PRK08703, PRK08703, short chain dehydrogenase; Pro 2e-06
PRK06196315 PRK06196, PRK06196, oxidoreductase; Provisional 2e-06
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 5e-06
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 2e-05
cd08954452 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase ( 2e-05
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 3e-05
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 3e-05
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote 5e-05
TIGR02685267 TIGR02685, pter_reduc_Leis, pteridine reductase 8e-05
cd11731198 cd11731, Lin1944_like_SDR_c, Lin1944 and related p 9e-05
TIGR01500256 TIGR01500, sepiapter_red, sepiapterin reductase 1e-04
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 2e-04
cd08951260 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 3e-04
pfam13561239 pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote 7e-04
PRK08303305 PRK08303, PRK08303, short chain dehydrogenase; Pro 0.002
PRK06924251 PRK06924, PRK06924, short chain dehydrogenase; Pro 0.003
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
 Score =  357 bits (919), Expect = e-126
 Identities = 136/203 (66%), Positives = 169/203 (83%)

Query: 5   VRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIRS 64
           +RFDGRV +VTGAG GLGR+YAL  AERGA VVVNDLGG R G GKSS AAD VV EI++
Sbjct: 1   LRFDGRVVLVTGAGGGLGRAYALAFAERGAKVVVNDLGGDRKGSGKSSSAADKVVDEIKA 60

Query: 65  KGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHL 124
            GGKAV NY+SV DG+KIV+TA++ FGR+DI++NNAGILRD+SFA++S+ DW LV  VHL
Sbjct: 61  AGGKAVANYDSVEDGEKIVKTAIDAFGRVDILVNNAGILRDRSFAKMSEEDWDLVMRVHL 120

Query: 125 TGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEK 184
            G+F+V+RAAWP+M+KQ +GR++ T+S +GL GNFGQANYSAAK+ L+GLSNTL+IEG K
Sbjct: 121 KGSFKVTRAAWPYMRKQKFGRIINTSSAAGLYGNFGQANYSAAKLGLLGLSNTLAIEGAK 180

Query: 185 NNIHCNVIVPTAASRLTEDILPP 207
            NI CN I P A SR+TE ++P 
Sbjct: 181 YNITCNTIAPAAGSRMTETVMPE 203


Beta oxidation of fatty acids in eukaryotes occurs by a four-reaction cycle, that may take place in mitochondria or in peroxisomes. (3R)-hydroxyacyl-CoA dehydrogenase is part of rat peroxisomal multifunctional MFE-2, it is a member of the NAD-dependent SDRs, but contains an additional small C-terminal domain that completes the active site pocket and participates in dimerization. The atypical, additional C-terminal extension allows for more extensive dimerization contact than other SDRs. MFE-2 catalyzes the second and third reactions of the peroxisomal beta oxidation cycle. Proteins in this subgroup have a typical catalytic triad, but have a His in place of the usual upstream Asn. This subgroup also contains members identified as 17-beta-hydroxysteroid dehydrogenases, including human peroxisomal 17-beta-hydroxysteroid dehydrogenase type 4 (17beta-HSD type 4, aka MFE-2, encoded by HSD17B4 gene) which is involved in fatty acid beta-oxidation and steroid metabolism. This subgroup also includes two SDR domains of the Neurospora crassa and Saccharomyces cerevisiae multifunctional beta-oxidation protein (MFP, aka Fox2). SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs. Length = 250

>gnl|CDD|236099 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|219957 pfam08659, KR, KR domain Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases Back     alignment and domain information
>gnl|CDD|180669 PRK06720, PRK06720, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|181126 PRK07806, PRK07806, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236389 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|187658 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 2, complex (x) Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|212496 cd11730, Tthb094_like_SDR_c, Tthb094 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187582 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatty acid synthase (FAS), complex (x) SDRs Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases (retinol-DHs), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235736 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187657 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 1, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|131732 TIGR02685, pter_reduc_Leis, pteridine reductase Back     alignment and domain information
>gnl|CDD|212497 cd11731, Lin1944_like_SDR_c, Lin1944 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|233441 TIGR01500, sepiapter_red, sepiapterin reductase Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|187654 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase Back     alignment and domain information
>gnl|CDD|236229 PRK08303, PRK08303, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
COG0300265 DltE Short-chain dehydrogenases of various substra 100.0
KOG1205|consensus282 100.0
KOG1201|consensus300 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
KOG1200|consensus256 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
KOG0725|consensus270 100.0
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07063260 short chain dehydrogenase; Provisional 100.0
PLN02730303 enoyl-[acyl-carrier-protein] reductase 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK07791286 short chain dehydrogenase; Provisional 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06139 330 short chain dehydrogenase; Provisional 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PRK06114254 short chain dehydrogenase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK06398258 aldose dehydrogenase; Validated 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07523255 gluconate 5-dehydrogenase; Provisional 100.0
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 100.0
PRK05599246 hypothetical protein; Provisional 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 100.0
KOG1207|consensus245 100.0
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PLN02253280 xanthoxin dehydrogenase 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK06484520 short chain dehydrogenase; Validated 100.0
PLN02780320 ketoreductase/ oxidoreductase 100.0
PRK07831262 short chain dehydrogenase; Provisional 100.0
PRK09242257 tropinone reductase; Provisional 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
PRK07067257 sorbitol dehydrogenase; Provisional 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK06124256 gluconate 5-dehydrogenase; Provisional 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07576264 short chain dehydrogenase; Provisional 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PRK07677252 short chain dehydrogenase; Provisional 100.0
PRK05993277 short chain dehydrogenase; Provisional 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK05717255 oxidoreductase; Validated 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PRK07109 334 short chain dehydrogenase; Provisional 100.0
PRK05866293 short chain dehydrogenase; Provisional 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 100.0
KOG1610|consensus322 100.0
PRK06484 520 short chain dehydrogenase; Validated 100.0
PRK06180277 short chain dehydrogenase; Provisional 100.0
PRK05854313 short chain dehydrogenase; Provisional 100.0
PRK07856252 short chain dehydrogenase; Provisional 100.0
PRK06182273 short chain dehydrogenase; Validated 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
PRK07024257 short chain dehydrogenase; Provisional 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK08703239 short chain dehydrogenase; Provisional 100.0
PRK06194287 hypothetical protein; Provisional 100.0
PRK06483236 dihydromonapterin reductase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK08263275 short chain dehydrogenase; Provisional 100.0
PRK12743256 oxidoreductase; Provisional 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
PRK05650270 short chain dehydrogenase; Provisional 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07454241 short chain dehydrogenase; Provisional 100.0
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 100.0
PRK06196315 oxidoreductase; Provisional 100.0
PRK06138252 short chain dehydrogenase; Provisional 100.0
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK07832272 short chain dehydrogenase; Provisional 100.0
PRK06179270 short chain dehydrogenase; Provisional 100.0
PRK08267260 short chain dehydrogenase; Provisional 100.0
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 100.0
PRK09072263 short chain dehydrogenase; Provisional 100.0
PRK07904253 short chain dehydrogenase; Provisional 100.0
PRK06057255 short chain dehydrogenase; Provisional 100.0
PRK12935247 acetoacetyl-CoA reductase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK05693274 short chain dehydrogenase; Provisional 100.0
PRK06482276 short chain dehydrogenase; Provisional 100.0
KOG1209|consensus289 100.0
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
PRK08213259 gluconate 5-dehydrogenase; Provisional 100.0
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK06197306 short chain dehydrogenase; Provisional 100.0
PRK06701290 short chain dehydrogenase; Provisional 100.0
PRK12939250 short chain dehydrogenase; Provisional 100.0
TIGR02415254 23BDH acetoin reductases. One member of this famil 100.0
PRK08251248 short chain dehydrogenase; Provisional 100.0
PRK10538248 malonic semialdehyde reductase; Provisional 100.0
PRK07775274 short chain dehydrogenase; Provisional 100.0
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK06914280 short chain dehydrogenase; Provisional 100.0
KOG1014|consensus312 100.0
KOG4169|consensus261 100.0
PRK06940275 short chain dehydrogenase; Provisional 100.0
PRK05875276 short chain dehydrogenase; Provisional 100.0
COG1028251 FabG Dehydrogenases with different specificities ( 100.0
PRK07774250 short chain dehydrogenase; Provisional 100.0
PRK09134258 short chain dehydrogenase; Provisional 100.0
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 100.0
PRK07069251 short chain dehydrogenase; Validated 100.0
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 100.0
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 100.0
PRK12742237 oxidoreductase; Provisional 100.0
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 100.0
PRK09186256 flagellin modification protein A; Provisional 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
KOG1208|consensus314 100.0
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 100.0
PRK12827249 short chain dehydrogenase; Provisional 100.0
PRK06198260 short chain dehydrogenase; Provisional 100.0
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PLN00015308 protochlorophyllide reductase 100.0
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.98
PRK12746254 short chain dehydrogenase; Provisional 99.98
PRK06123248 short chain dehydrogenase; Provisional 99.98
PRK07060245 short chain dehydrogenase; Provisional 99.98
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.98
PRK07577234 short chain dehydrogenase; Provisional 99.98
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.98
PRK06947248 glucose-1-dehydrogenase; Provisional 99.98
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.98
PRK07201657 short chain dehydrogenase; Provisional 99.98
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.98
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.98
PRK06181263 short chain dehydrogenase; Provisional 99.97
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.97
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.97
PRK07578199 short chain dehydrogenase; Provisional 99.97
PRK07102243 short chain dehydrogenase; Provisional 99.97
PRK07326237 short chain dehydrogenase; Provisional 99.97
PRK12828239 short chain dehydrogenase; Provisional 99.97
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK06101240 short chain dehydrogenase; Provisional 99.97
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.97
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
KOG1611|consensus249 99.97
PRK07074257 short chain dehydrogenase; Provisional 99.97
PRK08324681 short chain dehydrogenase; Validated 99.97
PRK06924251 short chain dehydrogenase; Provisional 99.97
PRK09291257 short chain dehydrogenase; Provisional 99.97
PRK12829264 short chain dehydrogenase; Provisional 99.97
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK08177225 short chain dehydrogenase; Provisional 99.97
PRK07023243 short chain dehydrogenase; Provisional 99.97
KOG1210|consensus331 99.97
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.97
PRK08264238 short chain dehydrogenase; Validated 99.97
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.97
PRK09135249 pteridine reductase; Provisional 99.97
PRK08017256 oxidoreductase; Provisional 99.96
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.96
KOG1199|consensus260 99.96
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK09009235 C factor cell-cell signaling protein; Provisional 99.96
PRK07041230 short chain dehydrogenase; Provisional 99.96
PRK07806248 short chain dehydrogenase; Provisional 99.96
PRK12367245 short chain dehydrogenase; Provisional 99.96
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.95
KOG1204|consensus253 99.95
PRK06953222 short chain dehydrogenase; Provisional 99.95
PRK08219227 short chain dehydrogenase; Provisional 99.94
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.93
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.92
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.92
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.92
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.91
KOG1478|consensus341 99.9
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.88
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.87
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.85
PLN03209 576 translocon at the inner envelope of chloroplast su 99.84
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 99.82
PRK06720169 hypothetical protein; Provisional 99.81
PLN02572 442 UDP-sulfoquinovose synthase 99.79
PLN02214 342 cinnamoyl-CoA reductase 99.78
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 99.78
PLN00198 338 anthocyanidin reductase; Provisional 99.77
PLN02653 340 GDP-mannose 4,6-dehydratase 99.76
PLN02650 351 dihydroflavonol-4-reductase 99.76
PLN02583297 cinnamoyl-CoA reductase 99.75
PLN02896 353 cinnamyl-alcohol dehydrogenase 99.75
PLN02240 352 UDP-glucose 4-epimerase 99.75
KOG1502|consensus 327 99.74
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 99.74
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.73
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 99.72
PRK10675 338 UDP-galactose-4-epimerase; Provisional 99.69
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 99.69
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 99.68
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.68
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.68
PLN02686367 cinnamoyl-CoA reductase 99.67
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.67
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.66
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.66
KOG4022|consensus236 99.65
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 99.65
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 99.65
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.64
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.62
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.61
PLN02427 386 UDP-apiose/xylose synthase 99.6
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.6
PF08643299 DUF1776: Fungal family of unknown function (DUF177 99.59
TIGR01746 367 Thioester-redct thioester reductase domain. It has 99.57
PLN02695 370 GDP-D-mannose-3',5'-epimerase 99.57
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.55
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.54
PLN02206 442 UDP-glucuronate decarboxylase 99.53
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.53
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.52
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.51
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.51
KOG1371|consensus 343 99.5
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 99.5
PLN02260 668 probable rhamnose biosynthetic enzyme 99.5
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 99.48
PLN02166 436 dTDP-glucose 4,6-dehydratase 99.48
PRK07201 657 short chain dehydrogenase; Provisional 99.4
PLN02778298 3,5-epimerase/4-reductase 99.38
CHL00194 317 ycf39 Ycf39; Provisional 99.37
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.37
PLN02996 491 fatty acyl-CoA reductase 99.36
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.3
PRK05865 854 hypothetical protein; Provisional 99.29
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 99.25
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.25
KOG1430|consensus 361 99.24
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 99.23
COG3320 382 Putative dehydrogenase domain of multifunctional n 99.21
KOG1202|consensus 2376 99.17
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.17
PLN02260668 probable rhamnose biosynthetic enzyme 99.13
PLN02503 605 fatty acyl-CoA reductase 2 99.1
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.06
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.0
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.96
PLN00016 378 RNA-binding protein; Provisional 98.92
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.87
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 98.87
PRK08309177 short chain dehydrogenase; Provisional 98.85
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.81
KOG0747|consensus 331 98.8
KOG1429|consensus 350 98.78
KOG1221|consensus 467 98.76
PRK12320 699 hypothetical protein; Provisional 98.67
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.66
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 98.59
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 98.56
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.5
COG4982 866 3-oxoacyl-[acyl-carrier protein] 98.5
KOG1203|consensus 411 98.42
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.41
KOG1431|consensus 315 98.36
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.24
PLN00106 323 malate dehydrogenase 98.22
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.18
PRK09620229 hypothetical protein; Provisional 98.17
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.16
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 98.16
KOG4039|consensus238 98.13
PRK14982340 acyl-ACP reductase; Provisional 98.13
KOG2865|consensus 391 98.11
COG2910211 Putative NADH-flavin reductase [General function p 98.07
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 98.01
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.95
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.89
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 97.88
KOG1372|consensus 376 97.79
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.71
PTZ00325 321 malate dehydrogenase; Provisional 97.67
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.64
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 97.63
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.62
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.62
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 97.59
PRK15116268 sulfur acceptor protein CsdL; Provisional 97.57
KOG2774|consensus 366 97.54
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 97.5
COG3007398 Uncharacterized paraquat-inducible protein B [Func 97.48
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.4
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 97.39
KOG1198|consensus347 97.39
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.31
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.28
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.27
PRK05086 312 malate dehydrogenase; Provisional 97.25
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 97.25
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 97.24
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 97.23
PRK06849 389 hypothetical protein; Provisional 97.2
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.2
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 97.2
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.19
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 97.17
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 97.16
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 97.16
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.12
COG2130340 Putative NADP-dependent oxidoreductases [General f 97.1
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 97.09
PRK13940414 glutamyl-tRNA reductase; Provisional 97.09
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.08
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.05
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.03
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.03
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.02
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 97.0
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 96.95
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.92
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.9
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 96.86
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.84
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.84
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.81
COG3268 382 Uncharacterized conserved protein [Function unknow 96.79
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.77
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 96.76
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.73
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.73
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.72
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.71
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 96.69
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 96.67
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.66
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.65
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 96.62
PRK14968188 putative methyltransferase; Provisional 96.62
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.61
KOG0023|consensus360 96.59
KOG2733|consensus 423 96.53
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.53
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.5
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 96.5
KOG1196|consensus343 96.47
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.43
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.42
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.4
PLN00203519 glutamyl-tRNA reductase 96.38
PRK06719157 precorrin-2 dehydrogenase; Validated 96.34
cd01483143 E1_enzyme_family Superfamily of activating enzymes 96.34
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.34
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 96.31
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 96.31
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.29
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 96.28
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.28
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.27
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.26
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.22
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 96.21
PF12076164 Wax2_C: WAX2 C-terminal domain; InterPro: IPR02194 96.14
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.13
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 96.13
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.12
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.11
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.09
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.09
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 96.09
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.02
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.01
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.99
PLN00112 444 malate dehydrogenase (NADP); Provisional 95.97
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 95.95
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 95.95
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 95.94
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.94
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 95.93
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 95.93
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 95.93
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 95.91
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.9
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 95.9
PLN02740381 Alcohol dehydrogenase-like 95.87
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.84
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 95.83
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 95.82
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.78
PRK05442 326 malate dehydrogenase; Provisional 95.77
PRK13243333 glyoxylate reductase; Reviewed 95.76
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.73
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 95.73
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.71
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 95.7
KOG4288|consensus283 95.7
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 95.68
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 95.67
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.67
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.66
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 95.63
PRK08223287 hypothetical protein; Validated 95.61
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.59
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 95.58
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 95.55
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 95.55
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 95.5
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.48
PLN02602 350 lactate dehydrogenase 95.47
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.47
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.42
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 95.42
PTZ00354334 alcohol dehydrogenase; Provisional 95.41
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 95.41
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 95.41
PTZ00082 321 L-lactate dehydrogenase; Provisional 95.34
PTZ00117 319 malate dehydrogenase; Provisional 95.32
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 95.3
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.29
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 95.27
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.26
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.25
PRK08655 437 prephenate dehydrogenase; Provisional 95.24
PLN02827378 Alcohol dehydrogenase-like 95.23
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 95.23
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 95.22
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 95.22
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 95.17
PRK08328231 hypothetical protein; Provisional 95.17
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 95.14
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 95.1
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 95.08
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.06
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 95.03
PLN02586360 probable cinnamyl alcohol dehydrogenase 95.03
PLN02178375 cinnamyl-alcohol dehydrogenase 95.03
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 95.02
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.98
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 94.97
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 94.96
PRK04148134 hypothetical protein; Provisional 94.92
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.92
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 94.9
TIGR01757 387 Malate-DH_plant malate dehydrogenase, NADP-depende 94.88
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.87
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.85
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 94.84
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 94.82
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 94.76
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 94.75
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.74
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.74
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.73
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.7
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.66
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.66
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 94.65
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 94.64
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.6
PRK13771334 putative alcohol dehydrogenase; Provisional 94.58
PRK12550272 shikimate 5-dehydrogenase; Reviewed 94.55
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 94.54
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 94.53
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=7.1e-44  Score=269.13  Aligned_cols=194  Identities=28%  Similarity=0.397  Sum_probs=181.5

Q ss_pred             ccCCcEEEEEcCCCchHHHHHHHHHHcCCeEEEEccCCCCCCCCCChhhhhHHHHHHHH-hCCccccccCCccchHHHHH
Q psy16220          6 RFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIRS-KGGKAVPNYNSVVDGDKIVQ   84 (223)
Q Consensus         6 ~~~~~~~lItGa~~giG~a~a~~l~~~G~~vv~~~r~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~   84 (223)
                      .+++|+++|||||+|||.++|+.|+++|++|++++|         ..++++++..++.+ .......|++|..+++++++
T Consensus         3 ~~~~kv~lITGASSGiG~A~A~~l~~~G~~vvl~aR---------R~drL~~la~~~~~~~~~~~~~DVtD~~~~~~~i~   73 (246)
T COG4221           3 TLKGKVALITGASSGIGEATARALAEAGAKVVLAAR---------REERLEALADEIGAGAALALALDVTDRAAVEAAIE   73 (246)
T ss_pred             CCCCcEEEEecCcchHHHHHHHHHHHCCCeEEEEec---------cHHHHHHHHHhhccCceEEEeeccCCHHHHHHHHH
Confidence            567899999999999999999999999999999987         88889999888874 34455679999999999999


Q ss_pred             HHHHhcCCccEEEeccCCCCCCCCCCCCHHHHHHHHHhhhhHHHHHHHHHHHHHHhcCCCcEEEEecCcccccCCCCchh
Q psy16220         85 TALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANY  164 (223)
Q Consensus        85 ~~~~~~~~id~li~~ag~~~~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~~~~~~g~iv~vsS~~~~~~~~~~~~y  164 (223)
                      .+.++|+++|+||||||.....++.+.+.++|+.|+++|+.|.++.+++++|.|.+++.|.||++||.++.++.|+...|
T Consensus        74 ~~~~~~g~iDiLvNNAGl~~g~~~~~~~~~dw~~Mid~Ni~G~l~~~~avLP~m~~r~~G~IiN~~SiAG~~~y~~~~vY  153 (246)
T COG4221          74 ALPEEFGRIDILVNNAGLALGDPLDEADLDDWDRMIDTNVKGLLNGTRAVLPGMVERKSGHIINLGSIAGRYPYPGGAVY  153 (246)
T ss_pred             HHHHhhCcccEEEecCCCCcCChhhhCCHHHHHHHHHHHHHHHHHHHHHhhhHHHhcCCceEEEeccccccccCCCCccc
Confidence            99999999999999999998899999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHhhhCCCCeEEEEEeCCCc-ccccccCCCCC
Q psy16220        165 SAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAA-SRLTEDILPPG  208 (223)
Q Consensus       165 ~~sK~a~~~~~~~l~~e~~~~~i~v~~v~Pg~v-t~~~~~~~~~~  208 (223)
                      +++|+++.+|++.|+.|+..++|||.+|.||.+ ++.+...-.++
T Consensus       154 ~ATK~aV~~fs~~LR~e~~g~~IRVt~I~PG~v~~~~~s~v~~~g  198 (246)
T COG4221         154 GATKAAVRAFSLGLRQELAGTGIRVTVISPGLVETTEFSTVRFEG  198 (246)
T ss_pred             hhhHHHHHHHHHHHHHHhcCCCeeEEEecCceecceecccccCCc
Confidence            999999999999999999999999999999999 88777766553



>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4039|consensus Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>COG3007 Uncharacterized paraquat-inducible protein B [Function unknown] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>KOG2733|consensus Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PF12076 Wax2_C: WAX2 C-terminal domain; InterPro: IPR021940 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>KOG4288|consensus Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 2e-82
1zbq_A327 Crystal Structure Of Human 17-beta-hydroxysteroid D 6e-81
1gz6_A319 (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat 1e-79
2et6_A 604 (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid 8e-66
3qlj_A322 Crystal Structure Of A Short Chain Dehydrogenase Fr 3e-37
1edo_A244 The X-Ray Structure Of Beta-Keto Acyl Carrier Prote 2e-32
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 9e-30
2uvd_A246 The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier 2e-29
1i01_A244 Crystal Structure Of Beta-Ketoacyl [acyl Carrier Pr 5e-28
1q7c_A244 The Structure Of Betaketoacyl-[acp] Reductase Y151f 1e-27
3sj7_A252 Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F 4e-27
2pnf_A248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 6e-27
3tzh_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 7e-27
3rsh_A251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 1e-26
4dml_A269 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Syn 1e-26
3tzc_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-26
3ftp_A270 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 3e-26
3osu_A246 Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Pro 4e-26
3tzk_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 5e-26
3u09_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 7e-26
3op4_A248 Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carr 3e-24
2cf2_E226 Architecture Of Mammalian Fatty Acid Synthase Lengt 3e-24
2c07_A285 Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng 3e-24
3pgx_A280 Crystal Structure Of A Putative Carveol Dehydrogena 3e-23
2q2q_A255 Structure Of D-3-Hydroxybutyrate Dehydrogenase From 1e-22
3enn_A249 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 1e-22
3emk_A246 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN 1e-22
2ph3_A245 Crystal Structure Of 3-oxoacyl-[acyl Carrier Protei 2e-22
1uls_A245 Crystal Structure Of Tt0140 From Thermus Thermophil 3e-22
3grp_A266 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- 4e-22
1zem_A262 Crystal Structure Of Nad+-Bound Xylitol Dehydrogena 8e-22
3lyl_A247 Structure Of 3-Oxoacyl-Acylcarrier Protein Reductas 8e-22
3gk3_A269 Crystal Structure Of Acetoacetyl-Coa Reductase From 2e-21
4iin_A271 Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car 2e-21
3t7c_A299 Crystal Structure Of Carveol Dehydrogenase From Myc 4e-21
3s55_A281 Crystal Structure Of A Putative Short-Chain Dehydro 6e-21
3tjr_A301 Crystal Structure Of A Rv0851c Ortholog Short Chain 7e-21
4afn_A269 Crystal Structure Of 3-ketoacyl-(acyl-carrier-prote 9e-21
1wmb_A260 Crystal Structure Of Nad Dependent D-3-Hydroxybutyl 1e-20
2ztu_A260 T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase C 1e-20
2ztm_A260 T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase L 2e-20
3oec_A317 Crystal Structure Of Carveol Dehydrogenase From Myc 2e-20
2yz7_A260 X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase F 9e-20
4fn4_A254 Short-chain Nad(h)-dependent Dehydrogenase/reductas 2e-19
1doh_A283 Structure Of Trihydroxynaphthalene Reductase In Com 2e-18
1ybv_A283 Structure Of Trihydroxynaphthalene Reductase In Com 2e-18
3qiv_A253 Crystal Structure Of A Putative Short-Chain Dehydro 2e-18
3u0b_A454 Crystal Structure Of An Oxidoreductase From Mycobac 3e-18
1g6k_A261 Crystal Structure Of Glucose Dehydrogenase Mutant E 4e-18
3r1i_A276 Crystal Structure Of A Short-Chain Type Dehydrogena 4e-18
1gco_A261 Crystal Structure Of Glucose Dehydrogenase Complexe 5e-18
1gee_A261 Crystal Structure Of Glucose Dehydrogenase Mutant Q 5e-18
1rwb_A261 Cooperative Effect Of Two Surface Amino Acid Mutati 5e-18
2nm0_A253 Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl 6e-18
3cxr_A291 Crystal Structure Of Gluconate 5-Dehydrogase From S 7e-18
2a4k_A263 3-Oxoacyl-[acyl Carrier Protein] Reductase From The 7e-18
3f9i_A249 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-17
3uve_A286 Crystal Structure Of Carveol Dehydrogenase ((+)-Tra 1e-17
3lls_A475 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 2e-17
4fw8_A454 Crystal Structure Of Fabg4 Complexed With Coenzyme 2e-17
3ezl_A256 Crystal Structure Of Acetyacetyl-Coa Reductase From 2e-17
3m1l_A432 Crystal Strucutre Of A C-Terminal Trunacted Mutant 2e-17
3q6i_A446 Crystal Structure Of Fabg4 And Coenzyme Binary Comp 2e-17
3v1t_C462 Crystal Structure Of A Putative Ketoacyl Reductase 2e-17
3csd_B281 Actinorhodin Polyketide Ketoreductase Mutant P94l B 2e-17
2rhr_B277 P94l Actinorhodin Ketordeuctase Mutant, With Nadph 2e-17
2pd6_A264 Structure Of Human Hydroxysteroid Dehydrogenase Typ 2e-17
2ntn_A267 Crystal Structure Of Maba-c60v/g139a/s144l Length = 3e-17
1nff_A260 Crystal Structure Of Rv2002 Gene Product From Mycob 3e-17
3uwr_A286 Crystal Structure Of Carveol Dehydrogenase From Myc 3e-17
4ibo_A271 Crystal Structure Of A Putative Gluconate Dehydroge 4e-17
3tox_A280 Crystal Structure Of A Short Chain Dehydrogenase In 4e-17
1uzm_A247 Maba From Mycobacterium Tuberculosis Length = 247 8e-17
4dc1_A281 Crystal Structure Of Y202f Actinorhodin Polyketide 1e-16
2rh4_A277 Actinorhodin Ketoreductase, Actkr, With Nadph And I 1e-16
4dbz_A281 Crystal Structure Of V151l Actinorhodin Polyketide 1e-16
1w4z_A281 Structure Of Actinorhodin Polyketide (Actiii) Reduc 2e-16
3gaf_A256 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid De 2e-16
1x7g_A261 Actinorhodin Polyketide Ketoreductase, Act Kr, With 2e-16
3nug_A247 Crystal Structure Of Wild Type Tetrameric Pyridoxal 2e-16
4dc0_A281 Crystal Structure Of F189w Actinorhodin Polyketide 2e-16
3pk0_A262 Crystal Structure Of Short-Chain DehydrogenaseREDUC 3e-16
3is3_A270 Crystal Structure Of 17beta-Hydroxysteroid Dehydrog 3e-16
4iiu_A267 Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car 6e-16
4dqx_A277 Crystal Structure Of A Short Chain Dehydrogenase Fr 6e-16
3itd_A270 Crystal Structure Of An Inactive 17beta-Hydroxyster 9e-16
3gdf_A267 Crystal Structure Of The Nadp-Dependent Mannitol De 1e-15
1uzl_A247 Maba From Mycobacterium Tuberculosis Length = 247 1e-15
1iy8_A267 Crystal Structure Of Levodione Reductase Length = 2 1e-15
1nfr_A260 Rv2002 Gene Product From Mycobacterium Tuberculosis 1e-15
3t4x_A267 Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDU 1e-15
3tsc_A277 Crystal Structure Of Short Chain Dehydrogenase Map_ 2e-15
3ndr_A247 Crystal Structure Of Tetrameric Pyridoxal 4-Dehydro 2e-15
3awd_A260 Crystal Structure Of Gox2181 Length = 260 2e-15
3ai1_A263 The Crystal Structure Of L-Sorbose Reductase From G 4e-15
3v2h_A281 The Crystal Structure Of D-Beta-Hydroxybutyrate Deh 5e-15
3i4f_A264 Structure Of Putative 3-oxoacyl-reductase From Baci 5e-15
1ahi_A255 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With 6e-15
3o38_A266 Crystal Structure Of A Short Chain Dehydrogenase Fr 7e-15
3ak4_A263 Crystal Structure Of Nadh-Dependent Quinuclidinone 1e-14
3aus_A269 Crystal Structure Of Bacillus Megaterium Glucose De 1e-14
3ay7_A269 Crystal Structure Of Bacillus Megaterium Glucose De 1e-14
3ay6_A269 Crystal Structure Of Bacillus Megaterium Glucose De 1e-14
3sx2_A278 Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Ca 1e-14
3o4r_A261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 1e-14
3uf0_A273 Crystal Structure Of A Putative Nad(P) Dependent Gl 1e-14
1geg_A256 Cryatal Structure Analysis Of Meso-2,3-Butanediol D 2e-14
2ew8_A249 Crystal Structure Of The (s)-specific 1-phenylethan 2e-14
1ipe_A259 Tropinone Reductase-Ii Complexed With Nadph Length 2e-14
2ae2_A260 Tropinone Reductase-Ii Complexed With Nadp+ And Pse 2e-14
3u5t_A267 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 4e-14
2fwm_X250 Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodih 5e-14
3sju_A279 Hedamycin Polyketide Ketoreductase Bound To Nadph L 6e-14
1ae1_A273 Tropinone Reductase-I Complex With Nadp Length = 27 8e-14
3ai3_A263 The Crystal Structure Of L-Sorbose Reductase From G 8e-14
4g81_D255 Crystal Structure Of A Hexonate Dehydrogenase Ortho 8e-14
1x1e_A239 Crystal Structure Of Tt0495 Protein From Thermus Th 1e-13
4hp8_A247 Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 1e-13
2cfc_A250 Structural Basis For Stereo Selectivity In The (R)- 2e-13
3f5q_A262 Crystal Structure Of Putative Short Chain Dehydroge 2e-13
3tfo_A264 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Car 2e-13
2d1y_A256 Crystal Structure Of Tt0321 From Thermus Thermophil 2e-13
4dyv_A272 Crystal Structure Of A Short-Chain DehydrogenaseRED 4e-13
3m1a_A281 The Crystal Structure Of A Short-Chain Dehydrogenas 8e-13
1yxm_A303 Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa 2e-12
1spx_A278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 2e-12
3f1l_A252 The 0.95 A Structure Of An Oxidoreductase, Ycik Fro 3e-12
3rih_A293 Crystal Structure Of A Putative Short Chain Dehydro 3e-12
3v2g_A271 Crystal Structure Of A DehydrogenaseREDUCTASE FROM 5e-12
1xkq_A280 Crystal Structure Of Short-Chain DehydrogenaseREDUC 8e-12
2o23_A265 The Structure Of Wild-Type Human Hadh2 (17beta-Hydr 8e-12
1so8_A261 Abeta-bound Human Abad Structure [also Known As 3-h 9e-12
1u7t_A261 Crystal Structure Of AbadHSD10 WITH A BOUND INHIBIT 9e-12
1vl8_A267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 9e-12
3kvo_A346 Crystal Structure Of The Catalytic Domain Of Human 1e-11
3uxy_A266 The Crystal Structure Of Short Chain Dehydrogenase 1e-11
3g1t_A258 Crystal Structure Of Short Chain Dehydrogenase From 1e-11
1e6w_A260 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 2e-11
1e3w_A261 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 2e-11
1e3s_A261 Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co 2e-11
3f5s_A255 Crystal Structure Of Putatitve Short Chain Dehydrog 2e-11
3v8b_A283 Crystal Structure Of A 3-Ketoacyl-Acp Reductase Fro 2e-11
2bd0_A244 Chlorobium Tepidum Sepiapterin Reductase Complexed 3e-11
1k2w_A256 Crystal Structure Of Sorbitol Dehydrogenase From R. 5e-11
2ehd_A234 Crystal Structure Analysis Of Oxidoreductase Length 8e-11
3vtz_A269 Structure Of Thermoplasma Volcanium Aldohexose Dehy 8e-11
4b79_A242 The Aeropath Project And Pseudomonas Aeruginosa Hig 8e-11
2ag5_A246 Crystal Structure Of Human Dhrs6 Length = 246 9e-11
4iqg_C271 Crystal Structure Of Bpro0239 Oxidoreductase From P 9e-11
2zat_A260 Crystal Structure Of A Mammalian Reductase Length = 1e-10
1xhl_A297 Crystal Structure Of Putative Tropinone Reductase-I 1e-10
1zjy_A251 Structure Of R-Specific Alcohol Dehydrogenase (Muta 1e-10
1ja9_A274 Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalen 1e-10
2y93_A281 Crystal Structure Of Cis-Biphenyl-2,3-Dihydrodiol-2 2e-10
2b4q_A276 Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex 2e-10
2gdz_A267 Crystal Structure Of 15-Hydroxyprostaglandin Dehydr 2e-10
2dtd_A264 Structure Of Thermoplasma Acidophilum Aldohexose De 3e-10
1nxq_A251 Crystal Structure Of R-Alcohol Dehydrogenase (Radh) 3e-10
3e9q_A273 Crystal Structure Of The Short Chain Dehydrogenase 3e-10
2zk7_A257 Structure Of A C-Terminal Deletion Mutant Of Thermo 4e-10
3f1k_A252 Crystal Structure Of Ycik From E. Coli, An Oxidored 4e-10
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 5e-10
1bdb_A277 Cis-Biphenyl-2,3-Dihydrodiol-2,3-Dehydrogenase From 5e-10
2jap_A247 Clavulanic Acid Dehydrogenase: Structural And Bioch 5e-10
3iah_A256 Crystal Structure Of Short Chain Dehydrogenase (yci 7e-10
3gvc_A277 Crystal Structure Of Probable Short-Chain Dehydroge 7e-10
3oic_A258 Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl 8e-10
2hsd_A253 The Refined Three-Dimensional Structure Of 3alpha,2 8e-10
1hdc_A254 Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste 8e-10
3sc4_A285 Crystal Structure Of A Short Chain Dehydrogenase (A 1e-09
3tl3_A257 Structure Of A Short-Chain Type DehydrogenaseREDUCT 1e-09
3n74_A261 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 1e-09
3ucx_A264 The Structure Of A Short Chain Dehydrogenase From M 2e-09
4fc6_A277 Studies On Dcr Shed New Light On Peroxisomal Beta-O 2e-09
4e6p_A259 Crystal Structure Of A Probable Sorbitol Dehydrogen 2e-09
3ijr_A291 2.05 Angstrom Resolution Crystal Structure Of A Sho 2e-09
2bgk_A278 X-Ray Structure Of Apo-Secoisolariciresinol Dehydro 2e-09
3i3o_A291 2.06 Angstrom Resolution Crystal Structure Of A Sho 2e-09
3ctm_A279 Crystal Structure Of A Carbonyl Reductase From Cand 3e-09
1xq1_A266 X-Ray Structure Of Putative Tropinone Reducatse Fro 4e-09
2qq5_A260 Crystal Structure Of Human Sdr Family Member 1 Leng 6e-09
2jah_A247 Biochemical And Structural Analysis Of The Clavulan 7e-09
3rkr_A262 Crystal Structure Of A Metagenomic Short-Chain Oxid 9e-09
1fdu_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 1e-08
1equ_A 327 Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin 1e-08
1fdw_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 1e-08
1fds_A 327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 1e-08
1xg5_A279 Structure Of Human Putative Dehydrogenase Mgc4172 I 1e-08
3pxx_A287 Crystal Structure Of Carveol Dehydrogenase From Myc 2e-08
1a27_A289 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 2e-08
1o5i_A249 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 3e-08
1iol_A 327 Estrogenic 17-beta Hydroxysteroid Dehydrogenase Com 3e-08
3edm_A259 Crystal Structure Of A Short Chain Dehydrogenase Fr 3e-08
3un1_A260 Crystal Structure Of An Oxidoreductase From Sinorhi 4e-08
4dry_A281 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 7e-08
2wdz_A254 Crystal Structure Of The Short Chain Dehydrogenase 8e-08
3tzq_B271 Crystal Structure Of A Short-Chain Type Dehydrogena 1e-07
3r3s_A294 Structure Of The Ygha Oxidoreductase From Salmonell 1e-07
2z1n_A260 Crystal Structure Of Ape0912 From Aeropyrum Pernix 1e-07
3ppi_A281 Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenas 2e-07
3ioy_A319 Structure Of Putative Short-Chain Dehydrogenase (Sa 2e-07
4fgs_A273 Crystal Structure Of A Probable Dehydrogenase Prote 2e-07
4eso_A255 Crystal Structure Of A Putative Oxidoreductase Prot 3e-07
3vc7_A254 Crystal Structure Of A Putative Oxidoreductase From 3e-07
3p19_A266 Improved Nadph-Dependent Blue Fluorescent Protein L 3e-07
3rku_A287 Substrate Fingerprint And The Structure Of Nadp+ De 3e-07
3ged_A247 Fingerprint And Structural Analysis Of A Apo Scor E 4e-07
3lz6_A263 Guinea Pig 11beta Hydroxysteroid Dehydrogenase With 6e-07
1xse_A295 Crystal Structure Of Guinea Pig 11beta-Hydroxystero 7e-07
3dwf_A276 Crystal Structure Of The Guinea Pig 11beta-Hydroxys 9e-07
3g49_A277 N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b- 9e-07
3a28_C258 Crystal Structure Of L-2,3-Butanediol Dehydrogenase 9e-07
3afm_A258 Crystal Structure Of Aldose Reductase A1-R Responsi 1e-06
3asu_A248 Crystal Structure Of Serine Dehydrogenase From Esch 1e-06
4e3z_A272 Crystal Structure Of A Oxidoreductase From Rhizobiu 1e-06
3imf_A257 1.99 Angstrom Resolution Crystal Structure Of A Sho 2e-06
3tn7_A257 Crystal Structure Of Short-Chain Alcohol Dehydrogen 2e-06
1hxh_A253 Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID D 2e-06
3l77_A235 X-Ray Structure Alcohol Dehydrogenase From Archaeon 3e-06
3u9l_A 324 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 7e-06
1xu7_A286 Crystal Structure Of The Interface Open Conformatio 7e-06
2rbe_A275 The Discovery Of 2-Anilinothiazolones As 11beta-Hsd 7e-06
2ilt_A275 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 7e-06
2bel_A283 Structure Of Human 11-Beta-Hydroxysteroid Dehydroge 7e-06
3d5q_A272 Crystal Structure Of 11b-Hsd1 In Complex With Triaz 8e-06
2irw_A264 Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W 8e-06
3pdj_A273 Crystal Structure Of Human 11-Beta-Hydroxysteroid D 8e-06
1y5m_A276 The Crystal Structure Of Murine 11b-Hydroxysteroid 8e-06
4bb5_A292 Free-Wilson And Structural Approaches To Co-Optimis 8e-06
1h5q_A265 Mannitol Dehydrogenase From Agaricus Bisporus Lengt 9e-06
3i1j_A247 Structure Of A Putative Short Chain Dehydrogenase F 1e-05
3ch6_A286 Crystal Structure Of 11beta-Hsd1 Double Mutant (L26 1e-05
4bb6_A292 Free-Wilson And Structural Approaches To Co-Optimis 1e-05
3icc_A255 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Car 1e-05
3lf1_A265 Apo Structure Of The Short Chain Oxidoreductase Q9h 1e-05
4hfr_A272 Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In 1e-05
3gmd_A264 Structure-Based Design Of 7-Azaindole-Pyrrolidines 1e-05
1cyd_A244 Carbonyl Reductase Complexed With Nadph And 2-Propa 2e-05
3e03_A274 Crystal Structure Of A Putative Dehydrogenase From 2e-05
1yde_A270 Crystal Structure Of Human Retinal Short-Chain Dehy 4e-05
3e9n_A245 Crystal Structure Of A Putative Short-Chain Dehydro 8e-05
3nyw_A250 Crystal Structure Of A Betaketoacyl-[acp] Reductase 2e-04
1pr9_A244 Human L-Xylulose Reductase Holoenzyme Length = 244 2e-04
3d3w_A244 Structure Of L-Xylulose Reductase With Bound Coenzy 2e-04
4imr_A275 Crystal Structure Of 3-oxoacyl (acyl-carrier-protei 3e-04
3tpc_A257 Crystal Structure Of A Hypothtical Protein Sma1452 7e-04
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure

Iteration: 1

Score = 301 bits (771), Expect = 2e-82, Method: Compositional matrix adjust. Identities = 137/203 (67%), Positives = 174/203 (85%) Query: 4 QVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIR 63 ++R+DGRVA+VTGAGAGLGR YALL AERGA VVVNDLGG GDG S +AAD VV EIR Sbjct: 14 KLRYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIR 73 Query: 64 SKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVH 123 GG+AV +YNSV+DG K+++TA++ FGR+DI++NNAGILRD+S + S+ DW LV DVH Sbjct: 74 KAGGEAVADYNSVIDGAKVIETAIKAFGRVDILVNNAGILRDRSLVKTSEQDWNLVNDVH 133 Query: 124 LTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGE 183 L G+F+ ++AA+P+MKKQNYGR++MT+SNSG+ GNFGQ NY+AAKM L+GL+NT++IEG Sbjct: 134 LKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGA 193 Query: 184 KNNIHCNVIVPTAASRLTEDILP 206 +NN+ CNVIVPTAASR+TE ILP Sbjct: 194 RNNVLCNVIVPTAASRMTEGILP 216
>pdb|1ZBQ|A Chain A, Crystal Structure Of Human 17-beta-hydroxysteroid Dehydrogenase Type 4 In Complex With Nad Length = 327 Back     alignment and structure
>pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 Length = 319 Back     alignment and structure
>pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 Back     alignment and structure
>pdb|3QLJ|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Avium Length = 322 Back     alignment and structure
>pdb|1EDO|A Chain A, The X-Ray Structure Of Beta-Keto Acyl Carrier Protein Reductase From Brassica Napus Complexed With Nadp+ Length = 244 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 Back     alignment and structure
>pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 Back     alignment and structure
>pdb|1Q7C|A Chain A, The Structure Of Betaketoacyl-[acp] Reductase Y151f Mutant In Complex With Nadph Fragment Length = 244 Back     alignment and structure
>pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 Back     alignment and structure
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|4DML|A Chain A, 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Synechococcus Elongatus Pcc 7942 Length = 269 Back     alignment and structure
>pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3FTP|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Burkholderia Pseudomallei At 2.05 A Resolution Length = 270 Back     alignment and structure
>pdb|3OSU|A Chain A, Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Protein Reductase, Fabg, From Staphylococcus Aureus Length = 246 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3OP4|A Chain A, Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Nadp+ Length = 248 Back     alignment and structure
>pdb|2CF2|E Chain E, Architecture Of Mammalian Fatty Acid Synthase Length = 226 Back     alignment and structure
>pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 Back     alignment and structure
>pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 Back     alignment and structure
>pdb|2Q2Q|A Chain A, Structure Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida Length = 255 Back     alignment and structure
>pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE FROM BRUCELLA Melitensis (P43212) Length = 249 Back     alignment and structure
>pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 Back     alignment and structure
>pdb|2PH3|A Chain A, Crystal Structure Of 3-oxoacyl-[acyl Carrier Protein] Reductase Ttha0415 From Thermus Thermophilus Length = 245 Back     alignment and structure
>pdb|1ULS|A Chain A, Crystal Structure Of Tt0140 From Thermus Thermophilus Hb8 Length = 245 Back     alignment and structure
>pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 Back     alignment and structure
>pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 Back     alignment and structure
>pdb|3LYL|A Chain A, Structure Of 3-Oxoacyl-Acylcarrier Protein Reductase, Fabg From Francisella Tularensis Length = 247 Back     alignment and structure
>pdb|3GK3|A Chain A, Crystal Structure Of Acetoacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 269 Back     alignment and structure
>pdb|4IIN|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Helicobacter Pylori 26695 Complexed With Nad+ Length = 271 Back     alignment and structure
>pdb|3T7C|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nad Length = 299 Back     alignment and structure
>pdb|3S55|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE From Mycobacterium Abscessus Bound To Nad Length = 281 Back     alignment and structure
>pdb|3TJR|A Chain A, Crystal Structure Of A Rv0851c Ortholog Short Chain Dehydrogenase From Mycobacterium Paratuberculosis Length = 301 Back     alignment and structure
>pdb|4AFN|A Chain A, Crystal Structure Of 3-ketoacyl-(acyl-carrier-protein) Reductase (fabg) From Pseudomonas Aeruginosa At 2.3a Resolution Length = 269 Back     alignment and structure
>pdb|1WMB|A Chain A, Crystal Structure Of Nad Dependent D-3-Hydroxybutylate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|2ZTU|A Chain A, T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase Complexed With Nad+ Length = 260 Back     alignment and structure
>pdb|2ZTM|A Chain A, T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|2YZ7|A Chain A, X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase From Alcaligenes Faecalis Length = 260 Back     alignment and structure
>pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 Back     alignment and structure
>pdb|1DOH|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And 4-nitro-inden-1-one Length = 283 Back     alignment and structure
>pdb|1YBV|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And An Active Site Inhibitor Length = 283 Back     alignment and structure
>pdb|3QIV|A Chain A, Crystal Structure Of A Putative Short-Chain Dehydrogenase Or 3- Oxoacyl-[acyl-Carrier-Protein] Reductase From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|3U0B|A Chain A, Crystal Structure Of An Oxidoreductase From Mycobacterium Smegmatis Length = 454 Back     alignment and structure
>pdb|1G6K|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant E96a Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|3R1I|A Chain A, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 276 Back     alignment and structure
>pdb|1GCO|A Chain A, Crystal Structure Of Glucose Dehydrogenase Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1GEE|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant Q252l Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1RWB|A Chain A, Cooperative Effect Of Two Surface Amino Acid Mutations (Q252l And E170k) Of Glucose Dehydrogenase From Bacillus Megaterium Iwg3 For The Stabilization Of Oligomeric State Length = 261 Back     alignment and structure
>pdb|2NM0|A Chain A, Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl Carrier Protein Reductase From Streptomyces Coelicolor A3(2) Length = 253 Back     alignment and structure
>pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 Back     alignment and structure
>pdb|2A4K|A Chain A, 3-Oxoacyl-[acyl Carrier Protein] Reductase From Thermus Thermophilus Tt0137 Length = 263 Back     alignment and structure
>pdb|3F9I|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase Rickettsia Prowazekii Length = 249 Back     alignment and structure
>pdb|3UVE|A Chain A, Crystal Structure Of Carveol Dehydrogenase ((+)-Trans-Carveol Dehydrogenase) From Mycobacterium Avium Length = 286 Back     alignment and structure
>pdb|3LLS|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Tuberculosis Length = 475 Back     alignment and structure
>pdb|4FW8|A Chain A, Crystal Structure Of Fabg4 Complexed With Coenzyme Nadh Length = 454 Back     alignment and structure
>pdb|3EZL|A Chain A, Crystal Structure Of Acetyacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 256 Back     alignment and structure
>pdb|3M1L|A Chain A, Crystal Strucutre Of A C-Terminal Trunacted Mutant Of A Putative Ketoacyl Reductase (Fabg4) From Mycobacterium Tuberculosis H37rv At 2.5 Angstrom Resolution Length = 432 Back     alignment and structure
>pdb|3Q6I|A Chain A, Crystal Structure Of Fabg4 And Coenzyme Binary Complex Length = 446 Back     alignment and structure
>pdb|3V1T|C Chain C, Crystal Structure Of A Putative Ketoacyl Reductase (Fabg4) From Mycobacterium Tuberculosis H37rv At 1.9 Angstrom Resolution Length = 462 Back     alignment and structure
>pdb|3CSD|B Chain B, Actinorhodin Polyketide Ketoreductase Mutant P94l Bound To Nadph And The Inhibitor Emodin Length = 281 Back     alignment and structure
>pdb|2RHR|B Chain B, P94l Actinorhodin Ketordeuctase Mutant, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|2PD6|A Chain A, Structure Of Human Hydroxysteroid Dehydrogenase Type 8, Hsd17b8 Length = 264 Back     alignment and structure
>pdb|2NTN|A Chain A, Crystal Structure Of Maba-c60v/g139a/s144l Length = 267 Back     alignment and structure
>pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3UWR|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Strain 104 Length = 286 Back     alignment and structure
>pdb|4IBO|A Chain A, Crystal Structure Of A Putative Gluconate Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506446) Length = 271 Back     alignment and structure
>pdb|3TOX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase In Complex With Nad(P) From Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|1UZM|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 Back     alignment and structure
>pdb|4DC1|A Chain A, Crystal Structure Of Y202f Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|2RH4|A Chain A, Actinorhodin Ketoreductase, Actkr, With Nadph And Inhibitor Emodin Length = 277 Back     alignment and structure
>pdb|4DBZ|A Chain A, Crystal Structure Of V151l Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|1W4Z|A Chain A, Structure Of Actinorhodin Polyketide (Actiii) Reductase Length = 281 Back     alignment and structure
>pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid Dehydrogenase From Brucella Melitensis Length = 256 Back     alignment and structure
>pdb|1X7G|A Chain A, Actinorhodin Polyketide Ketoreductase, Act Kr, With Nadp Bound Length = 261 Back     alignment and structure
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|4DC0|A Chain A, Crystal Structure Of F189w Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 Back     alignment and structure
>pdb|3PK0|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE SDR FROM Mycobacterium Smegmatis Length = 262 Back     alignment and structure
>pdb|3IS3|A Chain A, Crystal Structure Of 17beta-Hydroxysteroid Dehydrogenase (Apo Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|4IIU|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Escherichia Coli Strain Cft073 Complexed With Nadp+ At 2.1 A Resolution Length = 267 Back     alignment and structure
>pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 Back     alignment and structure
>pdb|3ITD|A Chain A, Crystal Structure Of An Inactive 17beta-Hydroxysteroid Dehydrogenase (Y167f Mutated Form) From Fungus Cochliobolus Lunatus Length = 270 Back     alignment and structure
>pdb|3GDF|A Chain A, Crystal Structure Of The Nadp-Dependent Mannitol Dehydrogenase From Cladosporium Herbarum. Length = 267 Back     alignment and structure
>pdb|1UZL|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 Back     alignment and structure
>pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 Back     alignment and structure
>pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3T4X|A Chain A, Short Chain DehydrogenaseREDUCTASE FAMILY OXIDOREDUCTASE FROM Bacillus Anthracis Str. Ames Ancestor Length = 267 Back     alignment and structure
>pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 Back     alignment and structure
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|3AWD|A Chain A, Crystal Structure Of Gox2181 Length = 260 Back     alignment and structure
>pdb|3AI1|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Reveals The Structure Bases Of Its Catalytic Mechanism And High Substrate Selectivity Length = 263 Back     alignment and structure
>pdb|3V2H|A Chain A, The Crystal Structure Of D-Beta-Hydroxybutyrate Dehydrogenase From Sinorhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|3I4F|A Chain A, Structure Of Putative 3-oxoacyl-reductase From Bacillus Thuringiensis Length = 264 Back     alignment and structure
>pdb|1AHI|A Chain A, 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With Nadh And 7-Oxo Glycochenodeoxycholic Acid Length = 255 Back     alignment and structure
>pdb|3O38|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 266 Back     alignment and structure
>pdb|3AK4|A Chain A, Crystal Structure Of Nadh-Dependent Quinuclidinone Reductase From Agrobacterium Tumefaciens Length = 263 Back     alignment and structure
>pdb|3AUS|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 In Ligand-Free Form Length = 269 Back     alignment and structure
>pdb|3AY7|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 G259a Mutant Length = 269 Back     alignment and structure
>pdb|3AY6|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 A258f Mutant In Complex With Nadh And D-Glucose Length = 269 Back     alignment and structure
>pdb|3SX2|A Chain A, Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Paratuberculosis In Complex With Nad Length = 278 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|3UF0|A Chain A, Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5- Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy) Length = 273 Back     alignment and structure
>pdb|1GEG|A Chain A, Cryatal Structure Analysis Of Meso-2,3-Butanediol Dehydrogenase Length = 256 Back     alignment and structure
>pdb|2EW8|A Chain A, Crystal Structure Of The (s)-specific 1-phenylethanol Dehydrogenase Of The Denitrifying Bacterium Strain Ebn1 Length = 249 Back     alignment and structure
>pdb|1IPE|A Chain A, Tropinone Reductase-Ii Complexed With Nadph Length = 259 Back     alignment and structure
>pdb|2AE2|A Chain A, Tropinone Reductase-Ii Complexed With Nadp+ And Pseudotropine Length = 260 Back     alignment and structure
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti Length = 267 Back     alignment and structure
>pdb|2FWM|X Chain X, Crystal Structure Of E. Coli Enta, A 2,3-Dihydrodihydroxy Benzoate Dehydrogenase Length = 250 Back     alignment and structure
>pdb|3SJU|A Chain A, Hedamycin Polyketide Ketoreductase Bound To Nadph Length = 279 Back     alignment and structure
>pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp Length = 273 Back     alignment and structure
>pdb|3AI3|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Length = 263 Back     alignment and structure
>pdb|4G81|D Chain D, Crystal Structure Of A Hexonate Dehydrogenase Ortholog (Target Efi- 506402 From Salmonella Enterica, Unliganded Structure Length = 255 Back     alignment and structure
>pdb|1X1E|A Chain A, Crystal Structure Of Tt0495 Protein From Thermus Thermophilus Hb8 Length = 239 Back     alignment and structure
>pdb|4HP8|A Chain A, Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 3-Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506435) With Bound Nadp Length = 247 Back     alignment and structure
>pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 Back     alignment and structure
>pdb|3F5Q|A Chain A, Crystal Structure Of Putative Short Chain Dehydrogenase From Escherichia Coli Cft073 Length = 262 Back     alignment and structure
>pdb|3TFO|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Carrier-Protein) Reductase From Sinorhizobium Meliloti Length = 264 Back     alignment and structure
>pdb|2D1Y|A Chain A, Crystal Structure Of Tt0321 From Thermus Thermophilus Hb8 Length = 256 Back     alignment and structure
>pdb|4DYV|A Chain A, Crystal Structure Of A Short-Chain DehydrogenaseREDUCTASE SDR FROM Xanthobacter Autotrophicus Py2 Length = 272 Back     alignment and structure
>pdb|3M1A|A Chain A, The Crystal Structure Of A Short-Chain Dehydrogenase From Streptomyces Avermitilis To 2a Length = 281 Back     alignment and structure
>pdb|1YXM|A Chain A, Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa Reductase Length = 303 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|3F1L|A Chain A, The 0.95 A Structure Of An Oxidoreductase, Ycik From E.Coli Length = 252 Back     alignment and structure
>pdb|3RIH|A Chain A, Crystal Structure Of A Putative Short Chain Dehydrogenase Or Reductase From Mycobacterium Abscessus Length = 293 Back     alignment and structure
>pdb|3V2G|A Chain A, Crystal Structure Of A DehydrogenaseREDUCTASE FROM SINORHIZOBIUM Meliloti 1021 Length = 271 Back     alignment and structure
>pdb|1XKQ|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE OF Unknown Function From Caenorhabditis Elegans With Cofactor Length = 280 Back     alignment and structure
>pdb|2O23|A Chain A, The Structure Of Wild-Type Human Hadh2 (17beta-Hydroxysteroid Dehydrogenase Type 10) Bound To Nad+ At 1.2 A Length = 265 Back     alignment and structure
>pdb|1SO8|A Chain A, Abeta-bound Human Abad Structure [also Known As 3-hydroxyacyl-coa Dehydrogenase Type Ii (type Ii Hadh), Endoplasmic Reticulum- Associated Amyloid Beta-peptide Binding Protein (erab)] Length = 261 Back     alignment and structure
>pdb|1U7T|A Chain A, Crystal Structure Of AbadHSD10 WITH A BOUND INHIBITOR Length = 261 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|3KVO|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Hydroxysteroid Dehydrogenase Like 2 (Hsdl2) Length = 346 Back     alignment and structure
>pdb|3UXY|A Chain A, The Crystal Structure Of Short Chain Dehydrogenase From Rhodobacter Sphaeroides Length = 266 Back     alignment and structure
>pdb|3G1T|A Chain A, Crystal Structure Of Short Chain Dehydrogenase From Salmonella Enterica Subsp. Enterica Serovar Typhi Str. Ct18 Length = 258 Back     alignment and structure
>pdb|1E6W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And Estradiol Length = 260 Back     alignment and structure
>pdb|1E3W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And 3-Keto Butyrate Length = 261 Back     alignment and structure
>pdb|1E3S|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh Length = 261 Back     alignment and structure
>pdb|3F5S|A Chain A, Crystal Structure Of Putatitve Short Chain Dehydrogenase From Shigella Flexneri 2a Str. 301 Length = 255 Back     alignment and structure
>pdb|3V8B|A Chain A, Crystal Structure Of A 3-Ketoacyl-Acp Reductase From Sinorhizobium Meliloti 1021 Length = 283 Back     alignment and structure
>pdb|2BD0|A Chain A, Chlorobium Tepidum Sepiapterin Reductase Complexed With Nadp And Sepiapterin Length = 244 Back     alignment and structure
>pdb|1K2W|A Chain A, Crystal Structure Of Sorbitol Dehydrogenase From R. Sphaeroides Length = 256 Back     alignment and structure
>pdb|2EHD|A Chain A, Crystal Structure Analysis Of Oxidoreductase Length = 234 Back     alignment and structure
>pdb|3VTZ|A Chain A, Structure Of Thermoplasma Volcanium Aldohexose Dehydrogenase Length = 269 Back     alignment and structure
>pdb|4B79|A Chain A, The Aeropath Project And Pseudomonas Aeruginosa High-throughput Crystallographic Studies For Assessment Of Potential Targets In Early Stage Drug Discovery. Length = 242 Back     alignment and structure
>pdb|2AG5|A Chain A, Crystal Structure Of Human Dhrs6 Length = 246 Back     alignment and structure
>pdb|4IQG|C Chain C, Crystal Structure Of Bpro0239 Oxidoreductase From Polaromonas Sp. Js666 In Nadp Bound Form Length = 271 Back     alignment and structure
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From Caenorhabditis Elegans With Cofactor And Substrate Length = 297 Back     alignment and structure
>pdb|1ZJY|A Chain A, Structure Of R-Specific Alcohol Dehydrogenase (Mutant G37d) From Lactobacillus Brevis In Complex With Phenylethanol And Nadh Length = 251 Back     alignment and structure
>pdb|1JA9|A Chain A, Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalene Reductase In Complex With Nadph And Pyroquilon Length = 274 Back     alignment and structure
>pdb|2Y93|A Chain A, Crystal Structure Of Cis-Biphenyl-2,3-Dihydrodiol-2,3- Dehydrogenase (Bphb)from Pandoraea Pnomenusa Strain B-356. Length = 281 Back     alignment and structure
>pdb|2B4Q|A Chain A, Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex Length = 276 Back     alignment and structure
>pdb|2GDZ|A Chain A, Crystal Structure Of 15-Hydroxyprostaglandin Dehydrogenase Type1, Complexed With Nad+ Length = 267 Back     alignment and structure
>pdb|2DTD|A Chain A, Structure Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (aldt) In Ligand-free Form Length = 264 Back     alignment and structure
>pdb|1NXQ|A Chain A, Crystal Structure Of R-Alcohol Dehydrogenase (Radh) (Apoenyzme) From Lactobacillus Brevis Length = 251 Back     alignment and structure
>pdb|3E9Q|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase From Shigella Flexneri Length = 273 Back     alignment and structure
>pdb|2ZK7|A Chain A, Structure Of A C-Terminal Deletion Mutant Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (Aldt) Length = 257 Back     alignment and structure
>pdb|3F1K|A Chain A, Crystal Structure Of Ycik From E. Coli, An Oxidoreductase, Complexed With Nadp+ At 2.6a Resolution Length = 252 Back     alignment and structure
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure
>pdb|1BDB|A Chain A, Cis-Biphenyl-2,3-Dihydrodiol-2,3-Dehydrogenase From Pseudomonas Sp. Lb400 Length = 277 Back     alignment and structure
>pdb|2JAP|A Chain A, Clavulanic Acid Dehydrogenase: Structural And Biochemical Analysis Of The Final Step In The Biosynthesis Of The Beta- Lactamase Inhibitor Clavulanic Acid Length = 247 Back     alignment and structure
>pdb|3IAH|A Chain A, Crystal Structure Of Short Chain Dehydrogenase (ycik) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. Lt2 In Complex With Nadp And Acetate. Length = 256 Back     alignment and structure
>pdb|3GVC|A Chain A, Crystal Structure Of Probable Short-Chain Dehydrogenase- Reductase From Mycobacterium Tuberculosis Length = 277 Back     alignment and structure
>pdb|3OIC|A Chain A, Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl) From B. Subtilis (Apo Form) Length = 258 Back     alignment and structure
>pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 Back     alignment and structure
>pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 Back     alignment and structure
>pdb|3SC4|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase (A0qtm2 Homolog) Mycobacterium Thermoresistibile Length = 285 Back     alignment and structure
>pdb|3TL3|A Chain A, Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Ulcerans Length = 257 Back     alignment and structure
>pdb|3N74|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reduc Brucella Melitensis Length = 261 Back     alignment and structure
>pdb|3UCX|A Chain A, The Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 264 Back     alignment and structure
>pdb|4FC6|A Chain A, Studies On Dcr Shed New Light On Peroxisomal Beta-Oxidation: Crystal Structure Of The Ternary Complex Of Pdcr Length = 277 Back     alignment and structure
>pdb|4E6P|A Chain A, Crystal Structure Of A Probable Sorbitol Dehydrogenase (Target Psi- 012078) From Sinorhizobium Meliloti 1021 Length = 259 Back     alignment and structure
>pdb|3IJR|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' In Complex With Nad+ Length = 291 Back     alignment and structure
>pdb|2BGK|A Chain A, X-Ray Structure Of Apo-Secoisolariciresinol Dehydrogenase Length = 278 Back     alignment and structure
>pdb|3I3O|A Chain A, 2.06 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' In Complex With Nad-acetone Length = 291 Back     alignment and structure
>pdb|3CTM|A Chain A, Crystal Structure Of A Carbonyl Reductase From Candida Parapsilosis With Anti-Prelog Stereo-Specificity Length = 279 Back     alignment and structure
>pdb|1XQ1|A Chain A, X-Ray Structure Of Putative Tropinone Reducatse From Arabidopsis Thaliana Gene At1g07440 Length = 266 Back     alignment and structure
>pdb|2QQ5|A Chain A, Crystal Structure Of Human Sdr Family Member 1 Length = 260 Back     alignment and structure
>pdb|2JAH|A Chain A, Biochemical And Structural Analysis Of The Clavulanic Acid Dehydeogenase (Cad) From Streptomyces Clavuligerus Length = 247 Back     alignment and structure
>pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 Back     alignment and structure
>pdb|1FDU|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221l Complexed With Estradiol And Nadp+ Length = 327 Back     alignment and structure
>pdb|1EQU|A Chain A, Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin Complexed With Nadp+ Length = 327 Back     alignment and structure
>pdb|1FDW|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221q Complexed With Estradiol Length = 327 Back     alignment and structure
>pdb|1FDS|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Complexed With 17- Beta-Estradiol Length = 327 Back     alignment and structure
>pdb|1XG5|A Chain A, Structure Of Human Putative Dehydrogenase Mgc4172 In Complex With Nadp Length = 279 Back     alignment and structure
>pdb|3PXX|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nicotinamide Adenine Dinucleotide Length = 287 Back     alignment and structure
>pdb|1A27|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C-Terminal Deletion Mutant Complexed With Estradiol And Nadp+ Length = 289 Back     alignment and structure
>pdb|1O5I|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Reductase (Tm1169) From Thermotoga Maritima At 2.50 A Resolution Length = 249 Back     alignment and structure
>pdb|1IOL|A Chain A, Estrogenic 17-beta Hydroxysteroid Dehydrogenase Complexed 17-beta- Estradiol Length = 327 Back     alignment and structure
>pdb|3EDM|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Agrobacterium Tumefaciens Length = 259 Back     alignment and structure
>pdb|3UN1|A Chain A, Crystal Structure Of An Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 260 Back     alignment and structure
>pdb|4DRY|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Rhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|2WDZ|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase Galactitol-Dehydrogenase (Gatdh) Of Rhodobacter Sphaeroides In Complex With Nad+ And 1,2-Pentandiol Length = 254 Back     alignment and structure
>pdb|3TZQ|B Chain B, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 271 Back     alignment and structure
>pdb|3R3S|A Chain A, Structure Of The Ygha Oxidoreductase From Salmonella Enterica Length = 294 Back     alignment and structure
>pdb|2Z1N|A Chain A, Crystal Structure Of Ape0912 From Aeropyrum Pernix K1 Length = 260 Back     alignment and structure
>pdb|3PPI|A Chain A, Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenase Type-2 From Mycobacterium Avium Length = 281 Back     alignment and structure
>pdb|3IOY|A Chain A, Structure Of Putative Short-Chain Dehydrogenase (Saro_0793) From Novosphingobium Aromaticivorans Length = 319 Back     alignment and structure
>pdb|4FGS|A Chain A, Crystal Structure Of A Probable Dehydrogenase Protein Length = 273 Back     alignment and structure
>pdb|4ESO|A Chain A, Crystal Structure Of A Putative Oxidoreductase Protein From Sinorhizobium Meliloti 1021 In Complex With Nadp Length = 255 Back     alignment and structure
>pdb|3VC7|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 254 Back     alignment and structure
>pdb|3P19|A Chain A, Improved Nadph-Dependent Blue Fluorescent Protein Length = 266 Back     alignment and structure
>pdb|3RKU|A Chain A, Substrate Fingerprint And The Structure Of Nadp+ Dependent Serine Dehydrogenase From Saccharomyces Cerevisiae Complexed With Nadp+ Length = 287 Back     alignment and structure
>pdb|3GED|A Chain A, Fingerprint And Structural Analysis Of A Apo Scor Enzyme From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|3LZ6|A Chain A, Guinea Pig 11beta Hydroxysteroid Dehydrogenase With Pf-877423 Length = 263 Back     alignment and structure
>pdb|1XSE|A Chain A, Crystal Structure Of Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Length = 295 Back     alignment and structure
>pdb|3DWF|A Chain A, Crystal Structure Of The Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Mutant F278e Length = 276 Back     alignment and structure
>pdb|3G49|A Chain A, N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b-Hydroxysteroid Dehydrogenase Type 1: Discovery Of Pf-915275 Length = 277 Back     alignment and structure
>pdb|3A28|C Chain C, Crystal Structure Of L-2,3-Butanediol Dehydrogenase Length = 258 Back     alignment and structure
>pdb|3AFM|A Chain A, Crystal Structure Of Aldose Reductase A1-R Responsible For Alginate Metabolism Length = 258 Back     alignment and structure
>pdb|3ASU|A Chain A, Crystal Structure Of Serine Dehydrogenase From Escherichia Coli Length = 248 Back     alignment and structure
>pdb|4E3Z|A Chain A, Crystal Structure Of A Oxidoreductase From Rhizobium Etli Cfn 42 Length = 272 Back     alignment and structure
>pdb|3IMF|A Chain A, 1.99 Angstrom Resolution Crystal Structure Of A Short Chain Dehydrogenase From Bacillus Anthracis Str. 'ames Ancestor' Length = 257 Back     alignment and structure
>pdb|3TN7|A Chain A, Crystal Structure Of Short-Chain Alcohol Dehydrogenase From Hyperthermophilic Archaeon Thermococcus Sibiricus Complexed With 5- Hydroxy-Nadp Length = 257 Back     alignment and structure
>pdb|1HXH|A Chain A, Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID Dehydrogenase Length = 253 Back     alignment and structure
>pdb|3L77|A Chain A, X-Ray Structure Alcohol Dehydrogenase From Archaeon Thermococcus Sibiricus Complexed With 5-Hydroxy-Nadp Length = 235 Back     alignment and structure
>pdb|3U9L|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase (Nadph) From Sinorhizobium Meliloti Length = 324 Back     alignment and structure
>pdb|1XU7|A Chain A, Crystal Structure Of The Interface Open Conformation Of Tetrameric 11b-hsd1 Length = 286 Back     alignment and structure
>pdb|2RBE|A Chain A, The Discovery Of 2-Anilinothiazolones As 11beta-Hsd1 Inhibitors Length = 275 Back     alignment and structure
>pdb|2ILT|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Sulfone Inhibitor Length = 275 Back     alignment and structure
>pdb|2BEL|A Chain A, Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase In Complex With Nadp And Carbenoxolone Length = 283 Back     alignment and structure
>pdb|3D5Q|A Chain A, Crystal Structure Of 11b-Hsd1 In Complex With Triazole Inhibitor Length = 272 Back     alignment and structure
>pdb|2IRW|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Ether Inhibitor Length = 264 Back     alignment and structure
>pdb|3PDJ|A Chain A, Crystal Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase 1 (11b-Hsd1) In Complex With 4,4-Disubstituted Cyclohexylbenzamide Inhibitor Length = 273 Back     alignment and structure
>pdb|1Y5M|A Chain A, The Crystal Structure Of Murine 11b-Hydroxysteroid Dehydrogenase: An Important Therapeutic Target For Diabetes Length = 276 Back     alignment and structure
>pdb|4BB5|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|1H5Q|A Chain A, Mannitol Dehydrogenase From Agaricus Bisporus Length = 265 Back     alignment and structure
>pdb|3I1J|A Chain A, Structure Of A Putative Short Chain Dehydrogenase From Pseudomonas Syringae Length = 247 Back     alignment and structure
>pdb|3CH6|A Chain A, Crystal Structure Of 11beta-Hsd1 Double Mutant (L262r, F278e) Complexed With (3,3-Dimethylpiperidin-1-Yl)(6-(3- Fluoro-4-Methylphenyl)pyridin-2-Yl)methanone Length = 286 Back     alignment and structure
>pdb|4BB6|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 Back     alignment and structure
>pdb|3ICC|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis At 1.87 A Resolution Length = 255 Back     alignment and structure
>pdb|3LF1|A Chain A, Apo Structure Of The Short Chain Oxidoreductase Q9hya2 From Pseudomonas Aeruginosa Pao1 Containing An Atypical Catalytic Center Length = 265 Back     alignment and structure
>pdb|4HFR|A Chain A, Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In Complex With An Orally Bioavailable Acidic Inhibitor Azd4017. Length = 272 Back     alignment and structure
>pdb|3GMD|A Chain A, Structure-Based Design Of 7-Azaindole-Pyrrolidines As Inhibitors Of 11beta-Hydroxysteroid-Dehydrogenase Type I Length = 264 Back     alignment and structure
>pdb|1CYD|A Chain A, Carbonyl Reductase Complexed With Nadph And 2-Propanol Length = 244 Back     alignment and structure
>pdb|3E03|A Chain A, Crystal Structure Of A Putative Dehydrogenase From Xanthomonas Campestris Length = 274 Back     alignment and structure
>pdb|1YDE|A Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 Length = 270 Back     alignment and structure
>pdb|3E9N|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE FROM CORYNEBACTERIUM GLUTAMICUM Length = 245 Back     alignment and structure
>pdb|3NYW|A Chain A, Crystal Structure Of A Betaketoacyl-[acp] Reductase (Fabg) From Bacteroides Thetaiotaomicron Length = 250 Back     alignment and structure
>pdb|1PR9|A Chain A, Human L-Xylulose Reductase Holoenzyme Length = 244 Back     alignment and structure
>pdb|3D3W|A Chain A, Structure Of L-Xylulose Reductase With Bound Coenzyme, Phosphate And Hydroxide Length = 244 Back     alignment and structure
>pdb|4IMR|A Chain A, Crystal Structure Of 3-oxoacyl (acyl-carrier-protein) Reductase (target Efi-506442) From Agrobacterium Tumefaciens C58 With Nadp Bound Length = 275 Back     alignment and structure
>pdb|3TPC|A Chain A, Crystal Structure Of A Hypothtical Protein Sma1452 From Sinorhizobium Meliloti 1021 Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 1e-125
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 1e-123
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 1e-120
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 1e-102
3qlj_A322 Short chain dehydrogenase; structural genomics, se 1e-114
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 1e-68
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 9e-66
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 2e-65
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 3e-64
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 3e-64
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 8e-64
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 1e-63
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 2e-63
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 8e-63
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 3e-62
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 3e-62
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 4e-62
3tsc_A277 Putative oxidoreductase; structural genomics, seat 4e-62
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 1e-61
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 2e-61
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 4e-61
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 5e-61
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 7e-61
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 7e-61
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 1e-60
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 1e-60
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 1e-60
3e03_A274 Short chain dehydrogenase; structural genomics, PS 2e-60
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 2e-60
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 3e-60
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 3e-60
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 3e-60
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 4e-60
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 4e-60
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 5e-60
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 6e-60
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 7e-60
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 9e-60
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 1e-59
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 1e-59
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 2e-59
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 2e-59
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 2e-59
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 3e-59
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 4e-59
3rih_A293 Short chain dehydrogenase or reductase; structural 5e-59
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 7e-59
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 9e-59
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 1e-58
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-58
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 2e-58
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 3e-58
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 6e-58
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 8e-58
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 9e-58
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 1e-57
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-57
1xq1_A266 Putative tropinone reducatse; structural genomics, 1e-57
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 2e-57
3imf_A257 Short chain dehydrogenase; structural genomics, in 2e-57
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 3e-57
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 3e-57
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 3e-57
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 4e-57
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 5e-57
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 7e-57
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 8e-57
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 1e-56
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 1e-56
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 1e-56
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 2e-56
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 2e-56
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 3e-56
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 3e-56
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 3e-56
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 3e-56
3cxt_A291 Dehydrogenase with different specificities; rossma 3e-56
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 4e-56
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 5e-56
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 7e-56
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 1e-55
4dqx_A277 Probable oxidoreductase protein; structural genomi 2e-55
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 2e-55
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 2e-55
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 2e-55
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 2e-55
3tjr_A301 Short chain dehydrogenase; structural genomics, se 2e-55
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 2e-55
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 3e-55
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 3e-55
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 3e-55
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 3e-55
3tox_A280 Short chain dehydrogenase; structural genomics, PS 3e-55
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 9e-55
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 1e-54
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 1e-54
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 2e-54
1xkq_A280 Short-chain reductase family member (5D234); parra 3e-54
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 3e-54
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 4e-54
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-54
1xhl_A297 Short-chain dehydrogenase/reductase family member 8e-54
3edm_A259 Short chain dehydrogenase; structural genomics, ox 1e-53
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 1e-53
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 2e-53
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 2e-53
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 3e-53
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 4e-53
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 4e-53
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 6e-53
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 6e-53
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 8e-53
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 1e-52
1nff_A260 Putative oxidoreductase RV2002; directed evolution 1e-52
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 1e-52
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 2e-52
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 3e-52
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 3e-52
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 5e-52
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 6e-52
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 6e-52
1spx_A278 Short-chain reductase family member (5L265); paral 9e-52
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 1e-51
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 1e-51
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 2e-51
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 2e-51
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 3e-51
4eso_A255 Putative oxidoreductase; NADP, structural genomics 5e-51
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 6e-51
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 1e-50
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 2e-50
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 2e-50
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 2e-50
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 4e-50
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 5e-50
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 8e-50
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 3e-49
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 3e-49
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 3e-49
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 5e-49
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 7e-49
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 2e-48
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 1e-47
3gem_A260 Short chain dehydrogenase; structural genomics, AP 2e-47
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 7e-47
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 1e-46
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 2e-46
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 5e-46
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 6e-46
4e4y_A244 Short chain dehydrogenase family protein; structur 7e-46
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 2e-45
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 6e-45
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 6e-44
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 1e-43
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 5e-42
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 3e-41
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 4e-41
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 5e-41
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 3e-40
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 4e-40
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 8e-40
1ooe_A236 Dihydropteridine reductase; structural genomics, P 2e-38
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 1e-36
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 3e-36
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 4e-35
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 4e-35
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 5e-35
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 5e-35
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 6e-34
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 1e-33
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 1e-33
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 5e-32
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 1e-31
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 2e-31
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 3e-30
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 6e-30
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 8e-28
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 2e-27
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 4e-27
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 2e-26
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 3e-26
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 2e-24
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 7e-19
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 1e-18
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 1e-16
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 3e-16
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 4e-12
3slk_A795 Polyketide synthase extender module 2; rossmann fo 6e-12
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 2e-11
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 5e-09
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 4e-07
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 8e-07
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 1e-06
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 5e-06
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
 Score =  356 bits (915), Expect = e-125
 Identities = 143/208 (68%), Positives = 170/208 (81%)

Query: 1   MPEQVRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVA 60
           M   +RFDGRV +VTGAG GLGR+YAL  AERGA VVVNDLGG   G GK S AAD VV 
Sbjct: 1   MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVE 60

Query: 61  EIRSKGGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQ 120
           EIR +GGKAV NY+SV  G+K+V+TAL+ FGRID+V+NNAGILRD+SF+RISD DW ++Q
Sbjct: 61  EIRRRGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQ 120

Query: 121 DVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSI 180
            VHL G+F+V+RAAW HMKKQNYGR++MTAS SG+ GNFGQANYSAAK+ L+GL+NTL I
Sbjct: 121 RVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVI 180

Query: 181 EGEKNNIHCNVIVPTAASRLTEDILPPG 208
           EG KNNIHCN I P A SR+TE ++P  
Sbjct: 181 EGRKNNIHCNTIAPNAGSRMTETVMPED 208


>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Length = 511 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Length = 496 Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Length = 525 Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Length = 486 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 100.0
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 100.0
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 100.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 100.0
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 100.0
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 100.0
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 100.0
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 100.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 100.0
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 100.0
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
3tjr_A301 Short chain dehydrogenase; structural genomics, se 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 100.0
3e03_A274 Short chain dehydrogenase; structural genomics, PS 100.0
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 100.0
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 100.0
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 100.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 100.0
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 100.0
3cxt_A291 Dehydrogenase with different specificities; rossma 100.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 100.0
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 100.0
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 100.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 100.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 100.0
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 100.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 100.0
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 100.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 100.0
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 100.0
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 100.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 100.0
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 100.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 100.0
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 100.0
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 100.0
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 100.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 100.0
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 100.0
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 100.0
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 100.0
3edm_A259 Short chain dehydrogenase; structural genomics, ox 100.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 100.0
1xhl_A297 Short-chain dehydrogenase/reductase family member 100.0
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 100.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 100.0
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 100.0
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 100.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 100.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 100.0
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 100.0
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 100.0
1xkq_A280 Short-chain reductase family member (5D234); parra 100.0
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 100.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 100.0
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3qlj_A322 Short chain dehydrogenase; structural genomics, se 100.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 100.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 100.0
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 100.0
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 100.0
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 100.0
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 100.0
1spx_A278 Short-chain reductase family member (5L265); paral 100.0
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 100.0
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 100.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 100.0
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 100.0
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 100.0
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 100.0
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 100.0
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 100.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 100.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 100.0
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 100.0
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 100.0
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 100.0
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 100.0
1xq1_A266 Putative tropinone reducatse; structural genomics, 100.0
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 100.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 100.0
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 100.0
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 100.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 100.0
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 100.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 100.0
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 100.0
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 100.0
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 100.0
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 100.0
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 100.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 100.0
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 100.0
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 100.0
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 100.0
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 100.0
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 100.0
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 100.0
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 100.0
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 100.0
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 100.0
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 100.0
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 100.0
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 100.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 100.0
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 100.0
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 100.0
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 100.0
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 100.0
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 100.0
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 100.0
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 100.0
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 100.0
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 100.0
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 100.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 100.0
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 100.0
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 100.0
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 100.0
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 100.0
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 100.0
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 100.0
1ooe_A236 Dihydropteridine reductase; structural genomics, P 100.0
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 100.0
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 100.0
4e4y_A244 Short chain dehydrogenase family protein; structur 100.0
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 100.0
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 100.0
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 100.0
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 100.0
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 100.0
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 100.0
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 100.0
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 100.0
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 100.0
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 100.0
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 100.0
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 100.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 100.0
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 100.0
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 100.0
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 100.0
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 100.0
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 100.0
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 100.0
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 100.0
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.97
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.97
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.97
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.97
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.97
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.96
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.96
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.96
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.96
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.94
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.94
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.94
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.93
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.92
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.91
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.89
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.89
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 99.89
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.89
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.88
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.88
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.87
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.87
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.86
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 99.86
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.86
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.86
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.86
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.86
1xq6_A253 Unknown protein; structural genomics, protein stru 99.86
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.86
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.85
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.85
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.85
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.85
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.85
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.84
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.84
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.84
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.84
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.84
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.84
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.83
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.83
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.83
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.83
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.83
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 99.83
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.83
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.83
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.82
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.82
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.82
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 99.81
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.81
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 99.81
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.81
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.8
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.8
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.8
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.8
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.8
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.8
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.8
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.8
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 99.79
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.79
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 99.79
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.79
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.79
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.78
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.78
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.78
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.77
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 99.77
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.77
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.76
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.76
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.76
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.75
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.73
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.73
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.73
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.72
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.72
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 99.68
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 99.68
4f6l_B 508 AUSA reductase domain protein; thioester reductase 99.66
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 99.65
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 99.63
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.62
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.62
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 99.61
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.59
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 99.59
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 99.57
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.54
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 99.5
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 99.48
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.47
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.46
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.45
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 99.4
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 99.27
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 99.24
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.21
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 99.14
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.8
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.8
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.68
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.68
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.61
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.59
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 98.54
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 98.51
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.51
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 98.49
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.47
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.42
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 98.42
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 98.38
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 98.37
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.33
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.32
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 98.31
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 98.29
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 98.29
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 98.27
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 98.27
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 98.24
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.23
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 98.23
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 98.22
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 98.21
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.2
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 98.19
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.17
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 98.17
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 98.16
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 98.16
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 98.08
3gms_A340 Putative NADPH:quinone reductase; structural genom 98.02
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.0
4eye_A342 Probable oxidoreductase; structural genomics, niai 97.96
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 97.95
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.94
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.93
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.91
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.9
3krt_A456 Crotonyl COA reductase; structural genomics, prote 97.88
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 97.87
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.87
3fbg_A346 Putative arginate lyase; structural genomics, unkn 97.86
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.85
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.83
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.81
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 97.7
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 97.69
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 97.69
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.67
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 97.63
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 97.59
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 97.58
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.57
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 97.57
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 97.56
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.49
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.49
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 97.48
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 97.47
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.44
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 97.44
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 97.43
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 97.41
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.39
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.39
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 97.38
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 97.37
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 97.35
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 97.35
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.32
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 97.31
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.31
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 97.3
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 97.29
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 97.28
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 97.26
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 97.26
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.25
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 97.24
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.24
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.24
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 97.24
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 97.23
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.23
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 97.21
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.2
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 97.19
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.18
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.18
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.16
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 97.16
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 97.14
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 97.11
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.09
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.09
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.08
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 97.07
3tl2_A 315 Malate dehydrogenase; center for structural genomi 97.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 97.0
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 96.97
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.93
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 96.92
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.9
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.86
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.83
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.83
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.81
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.74
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 96.73
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.73
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 96.69
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 96.68
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 96.67
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.66
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 96.66
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 96.65
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.61
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.54
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 96.52
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.51
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 96.5
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 96.49
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 96.46
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 96.45
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 96.39
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.33
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.32
2l82_A162 Designed protein OR32; structural genomics, northe 96.31
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.27
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 96.24
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 96.22
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.16
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.15
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 96.09
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.03
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.0
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 95.95
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 95.94
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 95.92
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 95.91
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 95.88
7mdh_A 375 Protein (malate dehydrogenase); chloroplastic mala 95.88
3l07_A285 Bifunctional protein fold; structural genomics, ID 95.88
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.86
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 95.84
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 95.83
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 95.81
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.8
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 95.8
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.79
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 95.79
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 95.77
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 95.76
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 95.73
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.71
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 95.69
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 95.69
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 95.68
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 95.66
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 95.64
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 95.63
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 95.62
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 95.62
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 95.61
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 95.61
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 95.6
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.59
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 95.58
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.55
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.55
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.53
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.53
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.52
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 95.5
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 95.5
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 95.49
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 95.48
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=100.00  E-value=1.6e-48  Score=304.83  Aligned_cols=193  Identities=33%  Similarity=0.496  Sum_probs=179.4

Q ss_pred             cccCCcEEEEEcCCCchHHHHHHHHHHcCCeEEEEccCCCCCCCCCChhhhhHHHHHHHHhCCcc---ccccCCccchHH
Q psy16220          5 VRFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIRSKGGKA---VPNYNSVVDGDK   81 (223)
Q Consensus         5 ~~~~~~~~lItGa~~giG~a~a~~l~~~G~~vv~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~   81 (223)
                      ++|+||++|||||++|||+++|+.|+++|++|++++|         +++.++++.+++++.+...   .+|++|.+++++
T Consensus         3 ~sL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~~~---------~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~   73 (254)
T 4fn4_A            3 QSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVEL---------LEDRLNQIVQELRGMGKEVLGVKADVSKKKDVEE   73 (254)
T ss_dssp             GGGTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEES---------CHHHHHHHHHHHHHTTCCEEEEECCTTSHHHHHH
T ss_pred             CCCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEEC---------CHHHHHHHHHHHHhcCCcEEEEEccCCCHHHHHH
Confidence            3789999999999999999999999999999999988         8888888889998776644   569999999999


Q ss_pred             HHHHHHHhcCCccEEEeccCCCC-CCCCCCCCHHHHHHHHHhhhhHHHHHHHHHHHHHHhcCCCcEEEEecCcccccCCC
Q psy16220         82 IVQTALENFGRIDIVINNAGILR-DKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFG  160 (223)
Q Consensus        82 ~~~~~~~~~~~id~li~~ag~~~-~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~~~~~~g~iv~vsS~~~~~~~~~  160 (223)
                      +++++.++||++|+||||||+.. ..++.+.+.++|++++++|+.++++++|.++|+|++++.|+||++||.++..+.++
T Consensus        74 ~~~~~~~~~G~iDiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~g~~~~~~  153 (254)
T 4fn4_A           74 FVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFA  153 (254)
T ss_dssp             HHHHHHHHHSCCCEEEECCCCCCTTCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGTCSSSS
T ss_pred             HHHHHHHHcCCCCEEEECCcccCCCCChhhCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCcEEEEEechhhcCCCCC
Confidence            99999999999999999999765 47899999999999999999999999999999999988899999999999999999


Q ss_pred             CchhhhhHHHHHHHHHHHHhhhCCCCeEEEEEeCCCc-ccccccCCC
Q psy16220        161 QANYSAAKMALVGLSNTLSIEGEKNNIHCNVIVPTAA-SRLTEDILP  206 (223)
Q Consensus       161 ~~~y~~sK~a~~~~~~~l~~e~~~~~i~v~~v~Pg~v-t~~~~~~~~  206 (223)
                      ..+|++||+|+.+|+|+|+.|++++|||||+|+||+| |++......
T Consensus       154 ~~~Y~asKaal~~ltr~lA~ela~~gIrVN~V~PG~i~T~~~~~~~~  200 (254)
T 4fn4_A          154 GAPYTVAKHGLIGLTRSIAAHYGDQGIRAVAVLPGTVKTNIGLGSSK  200 (254)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEECSBCSSCTTSCSS
T ss_pred             ChHHHHHHHHHHHHHHHHHHHhhhhCeEEEEEEeCCCCCcccccccC
Confidence            9999999999999999999999999999999999999 887765544



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 223
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 8e-64
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 1e-48
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 4e-47
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 2e-43
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 4e-43
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 6e-43
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 7e-43
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 5e-42
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 9e-40
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-39
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 1e-39
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-39
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 2e-39
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-38
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-38
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 6e-38
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 9e-38
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 1e-37
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 2e-37
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 2e-37
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-36
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 2e-36
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 5e-36
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 9e-36
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 3e-35
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 4e-35
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 5e-35
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 6e-35
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 8e-35
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 1e-34
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-34
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 4e-34
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 5e-34
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 1e-33
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 2e-33
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-33
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 3e-33
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 1e-32
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 2e-32
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 3e-32
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 1e-31
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 4e-31
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 8e-31
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 9e-31
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 1e-30
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 2e-30
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 6e-30
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 8e-29
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 9e-29
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 2e-27
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-27
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-27
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 1e-26
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 2e-26
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 5e-26
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 7e-25
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 7e-22
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 6e-19
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 4e-18
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 8e-16
d1e7wa_284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-15
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 4e-15
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 1e-14
d2pd4a1274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 3e-14
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 2e-12
d1uh5a_329 c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite 5e-10
d2h7ma1268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 2e-09
d1d7oa_297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 5e-09
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  198 bits (504), Expect = 8e-64
 Identities = 142/201 (70%), Positives = 168/201 (83%)

Query: 6   RFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIRSK 65
           RFDGRV +VTGAG GLGR+YAL  AERGA VVVNDLGG   G GK S AAD VV EIR +
Sbjct: 4   RFDGRVVLVTGAGGGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSSAADKVVEEIRRR 63

Query: 66  GGKAVPNYNSVVDGDKIVQTALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLT 125
           GGKAV NY+SV  G+K+V+TAL+ FGRID+V+NNAGILRD+SF+RISD DW ++Q VHL 
Sbjct: 64  GGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLR 123

Query: 126 GAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYSAAKMALVGLSNTLSIEGEKN 185
           G+F+V+RAAW HMKKQNYGR++MTAS SG+ GNFGQANYSAAK+ L+GL+NTL IEG KN
Sbjct: 124 GSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKN 183

Query: 186 NIHCNVIVPTAASRLTEDILP 206
           NIHCN I P A SR+TE ++P
Sbjct: 184 NIHCNTIAPNAGSRMTETVMP 204


>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 100.0
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 100.0
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 100.0
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 100.0
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 100.0
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 100.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 100.0
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 100.0
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 100.0
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 100.0
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 100.0
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 100.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.98
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.98
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.97
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.96
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.78
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.76
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.73
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.72
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.71
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.69
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.69
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.66
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.65
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.65
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.64
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.63
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.62
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.62
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.59
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.58
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.57
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.56
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.55
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.5
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.5
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.49
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.48
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.37
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.29
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.21
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.21
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.2
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.1
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 99.07
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 99.0
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 98.9
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.13
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.07
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.06
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 98.06
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.98
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.94
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.93
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.89
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.85
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 97.79
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.76
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.75
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.7
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.7
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.62
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.57
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.55
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.51
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 97.45
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.44
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.43
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.43
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 97.39
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.36
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.35
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.33
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.3
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 97.25
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.24
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.2
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.18
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 97.15
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.15
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.11
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.1
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 97.1
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.1
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.06
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.05
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.04
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.0
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 96.97
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.88
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.84
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.81
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.81
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.81
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 96.76
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.73
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.71
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.7
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.68
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.61
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.58
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.56
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.54
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.48
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.47
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.45
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.39
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.38
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.27
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.27
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.26
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.25
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.21
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.16
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.14
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.11
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.08
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.03
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.02
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.0
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.91
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.9
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.89
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.8
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.78
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.76
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.69
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.68
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.64
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.58
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.51
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.44
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.43
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.4
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.36
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 95.35
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.29
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.23
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.18
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.12
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 95.04
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 94.97
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.96
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 94.92
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.83
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.79
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 94.7
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.68
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 94.49
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.48
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.04
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.04
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.03
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.02
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.93
d2fr1a2209 Erythromycin synthase, eryAI, 1st ketoreductase mo 93.92
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 93.8
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 93.74
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.73
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 93.7
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 93.69
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.64
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 93.58
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 93.51
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.46
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 93.46
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.44
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 93.25
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 93.24
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 93.21
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 93.11
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 93.09
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.08
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 93.04
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 93.01
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 93.0
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 92.63
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 92.43
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 92.17
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.94
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 91.85
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 91.66
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 91.65
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 91.61
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 91.6
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.57
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 91.52
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 91.47
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.46
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 91.4
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 91.39
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 91.29
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 91.22
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 91.16
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 91.07
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 90.91
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 90.86
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 90.68
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.59
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 90.27
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 90.1
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 90.04
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.89
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 89.56
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 89.25
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.19
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 89.04
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 89.03
d2o14a2208 Hypothetical protein YxiM {Bacillus subtilis [TaxI 88.6
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 88.49
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 88.35
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 88.25
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.08
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 87.9
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 87.85
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 87.8
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 87.79
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.77
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 87.32
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.29
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 87.21
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 87.03
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 86.73
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 86.45
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 86.4
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 86.31
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 85.68
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 85.64
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 85.58
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 85.51
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 85.19
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 85.1
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 84.94
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 84.92
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 84.64
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 84.27
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.22
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 84.07
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 84.02
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 83.96
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 83.56
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 83.5
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 83.35
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 83.13
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.9
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 82.49
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 82.45
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 82.24
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 81.67
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 81.5
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 81.41
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 81.2
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 81.19
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 81.19
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 81.08
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 81.04
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 80.98
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 80.69
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 80.64
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 80.46
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 80.28
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 80.17
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: beta-keto acyl carrier protein reductase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=6.2e-49  Score=304.97  Aligned_cols=192  Identities=34%  Similarity=0.576  Sum_probs=181.4

Q ss_pred             ccCCcEEEEEcCCCchHHHHHHHHHHcCCeEEEEccCCCCCCCCCChhhhhHHHHHHHHhCCccccccCCccchHHHHHH
Q psy16220          6 RFDGRVAIVTGAGAGLGRSYALLLAERGASVVVNDLGGQRDGDGKSSKAADTVVAEIRSKGGKAVPNYNSVVDGDKIVQT   85 (223)
Q Consensus         6 ~~~~~~~lItGa~~giG~a~a~~l~~~G~~vv~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (223)
                      +|+||++|||||++|||+++|+.|+++|++|++++|         +++.++++.+++..+...+.+|++|.+++++++++
T Consensus         1 dl~gK~alITGas~GIG~a~a~~l~~~G~~Vv~~~r---------~~~~l~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~   71 (243)
T d1q7ba_           1 NFEGKIALVTGASRGIGRAIAETLAARGAKVIGTAT---------SENGAQAISDYLGANGKGLMLNVTDPASIESVLEK   71 (243)
T ss_dssp             CCTTCEEEESSCSSHHHHHHHHHHHHTTCEEEEEES---------SHHHHHHHHHHHGGGEEEEECCTTCHHHHHHHHHH
T ss_pred             CCCCCEEEEeCCCCHHHHHHHHHHHHcCCEEEEEeC---------CHHHHHHHHHHhCCCCcEEEEEecCHHHhhhhhhh
Confidence            589999999999999999999999999999999988         78888888888877777778899999999999999


Q ss_pred             HHHhcCCccEEEeccCCCCCCCCCCCCHHHHHHHHHhhhhHHHHHHHHHHHHHHhcCCCcEEEEecCcccccCCCCchhh
Q psy16220         86 ALENFGRIDIVINNAGILRDKSFARISDTDWQLVQDVHLTGAFRVSRAAWPHMKKQNYGRLVMTASNSGLLGNFGQANYS  165 (223)
Q Consensus        86 ~~~~~~~id~li~~ag~~~~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~~~~~~g~iv~vsS~~~~~~~~~~~~y~  165 (223)
                      +.+++|++|+||||||....+++.+.+.++|++++++|+.+++.++|.++|+|++++.|+||++||.++..+.++..+|+
T Consensus        72 ~~~~~g~iDilVnnAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~II~isS~~~~~~~~~~~~Y~  151 (243)
T d1q7ba_          72 IRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYA  151 (243)
T ss_dssp             HHHHTCSCSEEEECCCCCCCCCGGGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCHHHHHCCTTCHHHH
T ss_pred             hhcccCCcceehhhhhhccccccccccccccccccceeechhhhhHHHHHHHHHHcCCCEeeeecchhhcCCCCCCHHHH
Confidence            99999999999999999988999999999999999999999999999999999998889999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHhhhCCCCeEEEEEeCCCc-ccccccCCC
Q psy16220        166 AAKMALVGLSNTLSIEGEKNNIHCNVIVPTAA-SRLTEDILP  206 (223)
Q Consensus       166 ~sK~a~~~~~~~l~~e~~~~~i~v~~v~Pg~v-t~~~~~~~~  206 (223)
                      +||+|+.+|+|+|+.|++++|||||+|+||++ |++.....+
T Consensus       152 asKaal~~lt~~lA~ela~~gIrVN~I~PG~i~T~~~~~~~~  193 (243)
T d1q7ba_         152 AAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSD  193 (243)
T ss_dssp             HHHHHHHHHHHHHHHHHGGGTEEEEEEEECSBCCHHHHTSCH
T ss_pred             HHHHHHHHHHHHHHHHhCccCeEEEEEecceEechhhhhhhh
Confidence            99999999999999999999999999999999 887766543



>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fr1a2 c.2.1.2 (A:1448-1656) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2o14a2 c.23.10.8 (A:160-367) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure