Diaphorina citri psyllid: psy16232

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------

MHTSKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRLHGH

ccccHHHHHHcccccccEEEECccCEEEEEEEEECccHHHHHHHHcccccccEEEEccccHHHHHHHHHcEEccEEEEEcccHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccc

******EDVKRTERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQL***********************KLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRL***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHTSKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRLHGH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein TKR	Has a regulatory role during midline cell development.	confident	P14083

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0043229 [CC]	intracellular organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GA1, chain A
Confidence level:very confident
Coverage over the Query: 4-97
View the alignment between query and template
View the model in PyMOL