Psyllid ID: psy16232

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MHTSKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRLHGH
cccHHHHHHHHccccccEEEEEccEEEEEEEEEEEccHHHHHHHHcccccccEEEEccccHHHHHHHHHcEEccEEEEEcccHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccc
ccccHHHHHHcHccccEEEEccccccEHHHHHHHcccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHEEHHHHHHHcccEEEEcHHHHHHcccccHHHHHHHHHHccc
mhtsktedvkrteripcpaavgfstnikgdlcslslcpyfqkifsetpckhpvivlKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAenlqlptqQLFVLSfgyiplpaptsqkisGFTKKLSEMVIYLILKIIIPMLyefnglytvvnpeaqkimtpipqsFFLKVLRLHGH
mhtsktedvkrteripcpaavgfstnikGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRLHGH
MHTSKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRLHGH
**************IPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRL***
**TSKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQ*****************************************************************SFFLKVLRL***
***********TERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRLHGH
******EDVKRTERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQL***********************KLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRLHG*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHTSKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLCPYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQLPTQQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPMLYEFNGLYTVVNPEAQKIMTPIPQSFFLKVLRLHGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
P14083 1046 Protein TKR OS=Drosophila yes N/A 0.403 0.067 0.611 7e-20
Q9W0K4 1067 Protein bric-a-brac 2 OS= no N/A 0.397 0.065 0.507 1e-14
Q9W0K7 977 Protein bric-a-brac 1 OS= no N/A 0.352 0.063 0.523 2e-14
Q9V5M6 963 Longitudinals lacking pro no N/A 0.392 0.071 0.457 4e-13
Q7KQZ4 787 Longitudinals lacking pro no N/A 0.392 0.087 0.457 4e-13
P42284 549 Longitudinals lacking pro no N/A 0.392 0.125 0.457 4e-13
P42283 891 Longitudinals lacking pro no N/A 0.392 0.077 0.457 4e-13
Q9V5M3 878 Longitudinals lacking pro no N/A 0.392 0.078 0.457 5e-13
Q867Z4 970 Longitudinals lacking pro no N/A 0.392 0.071 0.457 8e-13
Q01295 727 Broad-complex core protei no N/A 0.420 0.101 0.454 2e-12
>sp|P14083|TKR_DROME Protein TKR OS=Drosophila melanogaster GN=Tkr PE=2 SV=2 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 59/72 (81%), Gaps = 1/72 (1%)

Query: 25  TNIKGDLCSLSLC-PYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQI 83
           T+I+     LS C P+FQ++F+ETPCKHPVIVLKD +GW +QAIVDFMY+GEISV Q ++
Sbjct: 149 TSIRAHKMVLSACSPFFQRVFAETPCKHPVIVLKDFRGWVVQAIVDFMYRGEISVPQQRL 208

Query: 84  TSLIKAAENLQL 95
            +LI+A E+LQ+
Sbjct: 209 QTLIQAGESLQV 220
Has a regulatory role during midline cell development.
Drosophila melanogaster (taxid: 7227)
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function description
>sp|Q9W0K7|BAB1_DROME Protein bric-a-brac 1 OS=Drosophila melanogaster GN=bab1 PE=2 SV=2 Back     alignment and function description
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function description
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q01295|BRC1_DROME Broad-complex core protein isoforms 1/2/3/4/5 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
242006896 750 tkr, putative [Pediculus humanus corpori 0.403 0.094 0.708 4e-21
270012342 567 hypothetical protein TcasGA2_TC006481 [T 0.403 0.125 0.694 5e-21
91088849 643 PREDICTED: similar to Tyrosine kinase-re 0.403 0.110 0.694 5e-21
555904115 BTB-III protein domain, partial [Drosoph 0.403 0.617 0.611 1e-18
195058118 1167 GH23133 [Drosophila grimshawi] gi|193899 0.403 0.060 0.611 2e-18
195489912 1044 GE11385 [Drosophila yakuba] gi|194179040 0.403 0.068 0.611 2e-18
194886981 1044 GG19859 [Drosophila erecta] gi|190659910 0.403 0.068 0.611 2e-18
170040820 545 tkr [Culex quinquefasciatus] gi|16786443 0.403 0.130 0.625 2e-18
158290006 874 AGAP010355-PA [Anopheles gambiae str. PE 0.403 0.081 0.611 2e-18
194756350 1099 GF11509 [Drosophila ananassae] gi|190621 0.403 0.064 0.611 2e-18
>gi|242006896|ref|XP_002424278.1| tkr, putative [Pediculus humanus corporis] gi|212507678|gb|EEB11540.1| tkr, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 60/72 (83%), Gaps = 1/72 (1%)

Query: 25  TNIKGDLCSLSLC-PYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQI 83
           T I+     LS C PYFQKIFSE PCKHP+IVLKD++GWE+QAIV FMYKGEISV QDQ+
Sbjct: 40  TKIRAHKVVLSACSPYFQKIFSENPCKHPIIVLKDLRGWEVQAIVYFMYKGEISVVQDQL 99

Query: 84  TSLIKAAENLQL 95
            +LIKAAE+LQ+
Sbjct: 100 QNLIKAAESLQV 111

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270012342|gb|EFA08790.1| hypothetical protein TcasGA2_TC006481 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91088849|ref|XP_971045.1| PREDICTED: similar to Tyrosine kinase-related protein CG16778-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|555904|gb|AAA50835.1| BTB-III protein domain, partial [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195058118|ref|XP_001995391.1| GH23133 [Drosophila grimshawi] gi|193899597|gb|EDV98463.1| GH23133 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195489912|ref|XP_002092939.1| GE11385 [Drosophila yakuba] gi|194179040|gb|EDW92651.1| GE11385 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194886981|ref|XP_001976723.1| GG19859 [Drosophila erecta] gi|190659910|gb|EDV57123.1| GG19859 [Drosophila erecta] Back     alignment and taxonomy information
>gi|170040820|ref|XP_001848184.1| tkr [Culex quinquefasciatus] gi|167864431|gb|EDS27814.1| tkr [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158290006|ref|XP_311585.4| AGAP010355-PA [Anopheles gambiae str. PEST] gi|157018432|gb|EAA07250.5| AGAP010355-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|194756350|ref|XP_001960442.1| GF11509 [Drosophila ananassae] gi|190621740|gb|EDV37264.1| GF11509 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
FB|FBgn0003715 1046 CG16778 [Drosophila melanogast 0.403 0.067 0.611 9.6e-19
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.397 0.065 0.507 2.4e-14
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.397 0.071 0.478 9.1e-14
FB|FBgn0030710 514 CG8924 [Drosophila melanogaste 0.352 0.120 0.531 3.9e-13
FB|FBgn0022238127 lolal "lola like" [Drosophila 0.352 0.488 0.476 7.1e-13
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.392 0.071 0.457 2.8e-12
FB|FBgn0263108 798 BtbVII "BTB-protein-VII" [Dros 0.352 0.077 0.476 3.5e-12
FB|FBgn0000210 880 br "broad" [Drosophila melanog 0.551 0.110 0.39 5.2e-12
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.397 0.086 0.408 2e-11
FB|FBgn0004652 955 fru "fruitless" [Drosophila me 0.392 0.072 0.457 3.2e-11
FB|FBgn0003715 CG16778 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 9.6e-19, P = 9.6e-19
 Identities = 44/72 (61%), Positives = 59/72 (81%)

Query:    25 TNIKGDLCSLSLC-PYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQI 83
             T+I+     LS C P+FQ++F+ETPCKHPVIVLKD +GW +QAIVDFMY+GEISV Q ++
Sbjct:   149 TSIRAHKMVLSACSPFFQRVFAETPCKHPVIVLKDFRGWVVQAIVDFMYRGEISVPQQRL 208

Query:    84 TSLIKAAENLQL 95
              +LI+A E+LQ+
Sbjct:   209 QTLIQAGESLQV 220
GO:0003677 "DNA binding" evidence=ISS;NAS
GO:0042332 "gravitaxis" evidence=IMP
GO:0007418 "ventral midline development" evidence=IMP
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030710 CG8924 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P14083TKR_DROMENo assigned EC number0.61110.40340.0678yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 2e-08
pfam00651101 pfam00651, BTB, BTB/POZ domain 5e-08
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information 
 Score = 49.2 bits (118), Expect = 2e-08
 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 31 LCSLSLCPYFQKIFSETPC--KHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIK 88
          L + S  PYF+ +FS          I L DV   + +A+++F+Y G++ + ++ +  L++
Sbjct: 18 LAAHS--PYFKALFSSDFKESDKSEIYLDDVSPEDFRALLNFLYTGKLDLPEENVEELLE 75

Query: 89 AAENLQLP 96
           A+ LQ+P
Sbjct: 76 LADYLQIP 83

Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
PHA02790 480 Kelch-like protein; Provisional 99.75
KOG4441|consensus 571 99.75
PHA02713 557 hypothetical protein; Provisional 99.75
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.71
PHA03098 534 kelch-like protein; Provisional 99.66
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.61
KOG4350|consensus 620 99.54
KOG4682|consensus 488 99.14
KOG2075|consensus 521 99.08
KOG4591|consensus280 98.96
KOG0783|consensus 1267 98.44
KOG0783|consensus 1267 98.33
KOG2838|consensus 401 97.66
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.56
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 97.46
KOG2716|consensus230 97.16
KOG3473|consensus112 97.02
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 96.94
KOG0511|consensus516 96.82
KOG0511|consensus 516 96.26
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 95.86
KOG2714|consensus 465 95.73
KOG2838|consensus401 95.14
KOG1665|consensus 302 94.48
KOG1724|consensus162 94.07
KOG3840|consensus 438 92.77
KOG1987|consensus297 88.04
KOG2723|consensus221 85.34
KOG2715|consensus210 82.3
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information 
Probab=99.75  E-value=7e-19  Score=155.16  Aligned_cols=134  Identities=14%  Similarity=0.081  Sum_probs=95.6

Q ss_pred             hhHHHHHhcCCCCcEEEEeCCeEEEeehhhhcch-HHHHHhhcC--CCCCCCeEEe--CCCCHHHHHHHhhhhccCceec
Q psy16232          4 SKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLC-PYFQKIFSE--TPCKHPVIVL--KDVQGWEIQAIVDFMYKGEISV   78 (176)
Q Consensus         4 s~~~~l~r~~~~~dv~l~v~~~~f~aHr~VLaa~-~yF~~lf~~--~e~~~~~I~l--~~v~~~~~~~lL~fiYtg~i~i   78 (176)
                      ++.-.+.+++++.||++++| +.|+|||+||||+ +|||+||++  .|+.. .|.+  .++++++++.+|+|+|||++.+
T Consensus        11 ~~~~~~~~~~~~~~~~~~~~-~~~~~HR~VLAa~S~YFraMF~~~~~Es~~-~v~~~~~~v~~~~l~~lldy~YTg~l~i   88 (480)
T PHA02790         11 KNILALSMTKKFKTIIEAIG-GNIIVNSTILKKLSPYFRTHLRQKYTKNKD-PVTRVCLDLDIHSLTSIVIYSYTGKVYI   88 (480)
T ss_pred             hhHHHHHhhhhhceEEEEcC-cEEeeehhhhhhcCHHHHHHhcCCcccccc-ceEEEecCcCHHHHHHHHHhheeeeEEE
Confidence            34456666666666766654 5999999999999 999999998  45543 4554  3899999999999999999999


Q ss_pred             CHHHHHHHHHHhhcccCCc------ccccccccCCCCCCCCCCccccCcchhhhHHHHHHhhhhhhcc
Q psy16232         79 GQDQITSLIKAAENLQLPT------QQLFVLSFGYIPLPAPTSQKISGFTKKLSEMVIYLILKIIIPM  140 (176)
Q Consensus        79 ~~~~v~~ll~aA~~l~v~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~k~~~~~  140 (176)
                      +.+|+++++.||++||++.      ..+....+.++|.....-+... ..+++.+.+..++.+.+...
T Consensus        89 t~~nV~~ll~aA~~Lqi~~v~~~C~~fL~~~l~~~NCl~i~~~A~~y-~~~~L~~~a~~fi~~nF~~v  155 (480)
T PHA02790         89 DSHNVVNLLRASILTSVEFIIYTCINFILRDFRKEYCVECYMMGIEY-GLSNLLCHTKDFIAKHFLEL  155 (480)
T ss_pred             ecccHHHHHHHHHHhChHHHHHHHHHHHHhhCCcchHHHHHHHHHHh-CHHHHHHHHHHHHHHhHHHH
Confidence            9999999999999999988      2222333444444333222233 33455566655555555443

>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>KOG3840|consensus Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>KOG2723|consensus Back     alignment and domain information
>KOG2715|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2vpk_A116 Myoneurin; transcription regulation, transcription 2e-10
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 1e-09
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 2e-09
3b84_A119 Zinc finger and BTB domain-containing protein 48; 2e-09
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 3e-09
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 3e-09
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 8e-09
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 1e-08
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 1e-08
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 1e-08
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 2e-08
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 4e-08
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 6e-08
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 1e-07
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 2e-07
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 1e-06
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 4e-04
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 4e-04
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
 Score = 54.1 bits (131), Expect = 2e-10
 Identities = 13/64 (20%), Positives = 31/64 (48%), Gaps = 1/64 (1%)

Query: 34  LSLC-PYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAEN 92
           L+    YF  I+  T   +  +    V+    Q +++F+Y G +++    +  + +AA+ 
Sbjct: 41  LASFSEYFGAIYRSTSENNVFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADY 100

Query: 93  LQLP 96
           L++ 
Sbjct: 101 LKVE 104
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.87
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.86
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.86
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.86
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.86
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.86
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.85
2vpk_A116 Myoneurin; transcription regulation, transcription 99.85
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.85
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.85
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.85
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.84
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.83
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.83
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.81
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.8
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.8
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.77
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.75
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.74
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.32
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.25
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.92
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.62
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.6
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.59
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.15
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 98.12
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.0
3kvt_A115 Potassium channel protein SHAW; tetramerization do 97.16
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 97.1
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 96.57
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 96.54
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 96.31
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 96.12
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 91.51
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
Probab=99.87  E-value=5.3e-22  Score=143.82  Aligned_cols=94  Identities=16%  Similarity=0.315  Sum_probs=88.2

Q ss_pred             hhHHHHHhcCCCCcEEEEeCCeEEEeehhhhcch-HHHHHhhcCCCCCCCeEEeCC-CCHHHHHHHhhhhccCceecCHH
Q psy16232          4 SKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLC-PYFQKIFSETPCKHPVIVLKD-VQGWEIQAIVDFMYKGEISVGQD   81 (176)
Q Consensus         4 s~~~~l~r~~~~~dv~l~v~~~~f~aHr~VLaa~-~yF~~lf~~~e~~~~~I~l~~-v~~~~~~~lL~fiYtg~i~i~~~   81 (176)
                      +.++++++++.+.||++.++|+.|+|||+|||++ +||++||.+.+.....|.+++ +++++|+.+|+|+|||++.++.+
T Consensus        21 ~~l~~l~~~~~~~Dv~l~v~~~~f~aHk~vLaa~S~yF~~~f~~~~~e~~~i~l~~~~~~~~f~~~l~~iYtg~~~~~~~  100 (125)
T 3ohu_A           21 LGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQTKNDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRE  100 (125)
T ss_dssp             HHHHHHHHHTCSCCEEEEETTEEEEECHHHHHHHBHHHHHHHTTCCCSSCEEECCTTCCHHHHHHHHHHHTTSEEEECTT
T ss_pred             HHHHHHHhcCCccceEEEECCEEEechHHHHHHcCHHHHHHhcCCCCCCcEEEeCCCCCHHHHHHHHHhHcCCceEECHH
Confidence            4567888888888899999999999999999999 999999998766688999998 99999999999999999999999


Q ss_pred             HHHHHHHHhhcccCCc
Q psy16232         82 QITSLIKAAENLQLPT   97 (176)
Q Consensus        82 ~v~~ll~aA~~l~v~~   97 (176)
                      ++.+++.+|++|++++
T Consensus       101 ~v~~ll~~A~~l~i~~  116 (125)
T 3ohu_A          101 NIREVIRCAEFLRMHN  116 (125)
T ss_dssp             THHHHHHHHHHHTBSS
T ss_pred             HHHHHHHHHHHhCCHH
Confidence            9999999999999998
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 176
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 5e-05
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 6e-05
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.9 bits (90), Expect = 5e-05
 Identities = 11/62 (17%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 37  CPYFQKIFSETPCKH--PVIVLKDVQGWEIQAIVDFMYKGEISVGQDQITSLIKAAENLQ 94
              F  IF++   ++   + +  ++       ++DFMY   +++ +  I +++  A  LQ
Sbjct: 48  SGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQ 107

Query: 95  LP 96
           + 
Sbjct: 108 ME 109
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.86
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.85
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.91
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.8
d3kvta_103 akv3.1 voltage-gated potassium channel {California 97.56
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 97.34
d1t1da_100 Shaker potassium channel {California sea hare (Apl 97.07
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 95.22
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 95.13
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=5.1e-22  Score=142.47  Aligned_cols=91  Identities=15%  Similarity=0.222  Sum_probs=84.2

Q ss_pred             hhHHHHHhcCCCCcEEEEeCCeEEEeehhhhcch-HHHHHhhcCCCCCCCeEEeCCCCHHHHHHHhhhhccCceecCHHH
Q psy16232          4 SKTEDVKRTERIPCPAAVGFSTNIKGDLCSLSLC-PYFQKIFSETPCKHPVIVLKDVQGWEIQAIVDFMYKGEISVGQDQ   82 (176)
Q Consensus         4 s~~~~l~r~~~~~dv~l~v~~~~f~aHr~VLaa~-~yF~~lf~~~e~~~~~I~l~~v~~~~~~~lL~fiYtg~i~i~~~~   82 (176)
                      +.+.++++++.+.|+++.++|+.|+|||+|||++ +||+++|.++   ..++.++++++++|+.+|+|+|||++.++.++
T Consensus        17 ~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~lf~~~---~~~i~~~~v~~~~f~~ll~~~Ytg~i~l~~~~   93 (121)
T d1buoa_          17 CKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRN---SQHYTLDFLSPKTFQQILEYAYTATLQAKAED   93 (121)
T ss_dssp             HHHHHHHHHTTTCCEEEEESSCEEEECHHHHHHHCHHHHHHTTSC---CSEEEECSSCHHHHHHHHHHHHHSCCCCCGGG
T ss_pred             HHHHHHHhcCCcEeEEEEECCEEEEEEHHHhcccChhhhhhccCc---cceeecCCCCHHHHHHHHHheEccccCCcHHH
Confidence            3567777788888899999999999999999999 9999999763   56899999999999999999999999999999


Q ss_pred             HHHHHHHhhcccCCc
Q psy16232         83 ITSLIKAAENLQLPT   97 (176)
Q Consensus        83 v~~ll~aA~~l~v~~   97 (176)
                      +.+++.+|++|++++
T Consensus        94 v~~ll~~A~~l~~~~  108 (121)
T d1buoa_          94 LDDLLYAAEILEIEY  108 (121)
T ss_dssp             HHHHHHHHHHHTCHH
T ss_pred             HHHHHHHHHHhCCHH
Confidence            999999999999988
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure