Diaphorina citri psyllid: psy16240


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MEHPPPSPQENPKYATVSLFPLSFLSSGVDVTANQEEISDHETFQLEFDPSTKRWYIRTMQDRYWTLETGGGMIEEESRLFSNPSKVRTVLQYLEVKIQYFYGLYCTDKPSKFKIYSVPLSFLSSGVDVTANQEEISDHETFQLEFDPSTKRWYIRTMQDRYWTLETGGGIQASGDKKSSNALYDLVWQGDGSVALRANNGKFIATKRSGHLYANSDSADDSCRYYFYLINRPILVLKCEQGFVGFKTGANNSLRLECNKANYETIQVERADRGVVYFKGKSAR
cccccccccccccEEEEECcccEEEcccCEEEECcccccccCEEEEEEEcccccEEEEEccccEEEECccccEEEcccccccccccCEEEEEEEEEEEEEEccCEEECccccEEEEEccCEEEEcccEEECccccccccCEEEEEEcccccEEEEEEccccEEEEEccccEEEcccccccccEEEEEEccccEEEEEcccccEEEEccccEEEECccccccccEEEEEEEcccEEEEEEcccEEEEEcccccccEEEEccccccEEEEEEccccEEEEEccccc
*********ENPKYATVSLFPLSFLSSGVDVTANQEEISDHETFQLEFDPSTKRWYIRTMQDRYWTLETGGGMIEEESRLFSNPSKVRTVLQYLEVKIQYFYGLYCTDKPSKFKIYSVPLSFLSSGVDVTANQEEISDHETFQLEFDPSTKRWYIRTMQDRYWTLETGGGIQA*****SSNALYDLVWQGDGSVALRANNGKFIATKRSGHLYANSDSADDSCRYYFYLINRPILVLKCEQGFVGFKTGANNSLRLECNKANYETIQVERADRGVVYFKGK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHPPPSPQENPKYATVSLFPLSFLSSGVDVTANQEEISDHETFQLEFDPSTKRWYIRTMQDRYWTLETGGGMIEEESRLFSNPSKVRTVLQYLEVKIQYFYGLYCTDKPSKFKIYSVPLSFLSSGVDVTANQEEISDHETFQLEFDPSTKRWYIRTMQDRYWTLETGGGIQASGDKKSSNALYDLVWQGDGSVALRANNGKFIATKRSGHLYANSDSADDSCRYYFYLINRPILVLKCEQGFVGFKTGANNSLRLECNKANYETIQVERADRGVVYFKGKSAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein singed Probably acts as an actin bundling protein. May have a role in the asymmetric organization and/or movement of cytoplasmic components. It has a role in somatic cells during the formation of adult bristles and hairs, and in the female germline during oogenesis.confidentQ24524

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0051017 [BP]actin filament bundle assemblyprobableGO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0030036, GO:0044085, GO:0044763, GO:0016043, GO:0008150, GO:0071840
GO:0031941 [CC]filamentous actinprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005884, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LLP, chain A
Confidence level:very confident
Coverage over the Query: 17-284
View the alignment between query and template
View the model in PyMOL