Diaphorina citri psyllid: psy16241


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
KIRCTVDQGTDRWLLFLNQHNLDPALYWPDLVTGDFDSVSSNSMGRFLALGSDIVPTPDQSYTDFQKAVMEITKREKIDYLISIVEFNGRLDHCMSNINTLYKSSLPIYLLSAKYMSWVLRANAGLHRIHLNPGFTSGKKTLGLIPVGSPVQQVYSTGLKWNLNNHTLAFGGMVSSSNTYENETTP
cEEEEECcccHHHHHHHHHcccccccccccEEECccccccHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEccEEEEEEEccccEEEEEccccccccccCEEEECcccccccEEEEccEEEccccEEEcccEEEEEEEECccccc
KIRCTVDQGTDRWLLFLNQHNLDPALYWPDLVTGDFDSVSSNSMGRFLALGSDIVPTPDQSYTDFQKAVMEITKREKIDYLISIVEFNGRLDHCMSNINTLYKSSLPIYLLSAKYMSWVLRANAGLHRIHLNPGFTSGKKTLGLIPVGSPVQQVYSTGLKWNLNNHTLAFGGMVSSSNTYENE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KIRCTVDQGTDRWLLFLNQHNLDPALYWPDLVTGDFDSVSSNSMGRFLALGSDIVPTPDQSYTDFQKAVMEITKREKIDYLISIVEFNGRLDHCMSNINTLYKSSLPIYLLSAKYMSWVLRANAGLHRIHLNPGFTSGKKTLGLIPVGSPVQQVYSTGLKWNLNNHTLAFGGMVSSSNTYENETTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thiamin pyrophosphokinase 1 Catalyzes the phosphorylation of thiamine to thiamine pyrophosphate. Can also catalyze the phosphorylation of pyrithiamine to pyrithiamine pyrophosphate.confidentQ9R0M5
Thiamin pyrophosphokinase 1 Catalyzes the phosphorylation of thiamine to thiamine pyrophosphate. Can also catalyze the phosphorylation of pyrithiamine to pyrithiamine pyrophosphate.confidentQ9H3S4
Thiamin pyrophosphokinase 1 Catalyzes the phosphorylation of thiamine to thiamine pyrophosphate. Can also catalyze the phosphorylation of pyrithiamine to pyrithiamine pyrophosphate.confidentQ5E9T4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006772 [BP]thiamine metabolic processprobableGO:0044710, GO:0042723, GO:0006766, GO:1901564, GO:0009987, GO:0006725, GO:0006767, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0044281, GO:0008152, GO:0008150, GO:0046483, GO:1901360, GO:0072527
GO:0004788 [MF]thiamine diphosphokinase activityprobableGO:0016772, GO:0016740, GO:0016778, GO:0003674, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2G9Z, chain A
Confidence level:very confident
Coverage over the Query: 1-184
View the alignment between query and template
View the model in PyMOL