Diaphorina citri psyllid: psy16255


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MSGNKVMQHAQNLKFQRVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRPRLPLDT
cccccccHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccEEEEEEcccEEEEEcccHHHHHHHHcccccccccEEEEcccccccccccHHHHHcccccccccEEEEcccccccccccCEEEECccccccEEccEEEEEEcccccccccc
************************MKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRPRLP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGNKVMQHAQNLKFQRVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRPRLPLDT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc phosphodiesterase ELAC protein 2 Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.confidentQ8CGS5
Zinc phosphodiesterase ELAC protein 2 Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.confidentQ80Y81
Ribonuclease Z, mitochondrial Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity of nuclear and mitochondrial pre-tRNA. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA. May participate in tRNA processing in the developing embryo.confidentQ8MKW7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016891 [MF]endoribonuclease activity, producing 5'-phosphomonoestersprobableGO:0016787, GO:0003824, GO:0004518, GO:0004519, GO:0004540, GO:0004521, GO:0016788, GO:0016893, GO:0003674
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042779 [BP]tRNA 3'-trailer cleavageprobableGO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0034470, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0042780, GO:0008033, GO:0009987, GO:0006725, GO:0031123, GO:0008150, GO:0008152, GO:0043628, GO:0046483, GO:0016070, GO:0044238, GO:0090501, GO:0044237, GO:0043170, GO:0006399, GO:0006396

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CBN, chain A
Confidence level:very confident
Coverage over the Query: 31-154
View the alignment between query and template
View the model in PyMOL