Psyllid ID: psy16255

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MSGNKVMQHAQNLKFQRVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRPRLPLDT
cccccccHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccEEEEEEcccEEEEEccHHHHHHHHHcccccccccEEEEcccccccccccHHHHHcccccccccEEEEcccccccccccEEEEEEccccccEEccEEEEEEcccccccccc
ccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEccccccccEEEEEEcccEEEEEcccHHHHHHHHcccEEEEEcEEEEEEccHcccccccHHHEEHHHccccEEEEEccccccHccccccccccccccccHEEEEEEEEEcccccccccc
MSGNKVMQHAQNLKFQRVKMREKsmkyvpgivnlqvlgsgargapkslylftdqsrylfncgeGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALtiqdvgvpeinlhgpeglvsenmglasnsispsdpALIQARTlmkiplrprlpldt
msgnkvmqhaqnlkfqrVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQArtlmkiplrprlpldt
MSGNKVMQHAQNLKFQRVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRPRLPLDT
************************MKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGP*****************************************
*********************************LQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRPRLP***
**********QNLKFQRVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRPRLPLDT
*********AQNLKFQRVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRP******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGNKVMQHAQNLKFQRVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVSENMGLASNSISPSDPALIQARTLMKIPLRPRLPLDT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
Q8MKW7 766 Ribonuclease Z, mitochond yes N/A 0.647 0.131 0.663 7e-35
Q9BQ52 826 Zinc phosphodiesterase EL yes N/A 0.576 0.108 0.5 2e-22
Q9GL72 826 Zinc phosphodiesterase EL yes N/A 0.576 0.108 0.5 3e-22
Q9GL73 826 Zinc phosphodiesterase EL N/A N/A 0.576 0.108 0.488 8e-22
Q8HY87 826 Zinc phosphodiesterase EL N/A N/A 0.557 0.105 0.517 1e-21
Q80Y81 831 Zinc phosphodiesterase EL yes N/A 0.576 0.108 0.511 3e-20
Q8CGS5 827 Zinc phosphodiesterase EL yes N/A 0.557 0.105 0.517 2e-19
P36159 838 Ribonuclease Z OS=Sacchar yes N/A 0.371 0.069 0.416 4e-06
B2J3C7 319 Ribonuclease Z OS=Nostoc yes N/A 0.397 0.194 0.396 7e-06
Q89ZN1 316 Ribonuclease Z OS=Bactero yes N/A 0.769 0.379 0.265 7e-06
>sp|Q8MKW7|RNZ_DROME Ribonuclease Z, mitochondrial OS=Drosophila melanogaster GN=JhI-1 PE=1 SV=2 Back     alignment and function desciption
 Score =  145 bits (367), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 80/101 (79%)

Query: 20  MREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKL 79
           +R+K    VPG VNLQVLGSGA GAP ++YLFTDQ+RYLFNCGEGTQRLAHEHK +L++L
Sbjct: 47  LRKKLASVVPGTVNLQVLGSGANGAPAAVYLFTDQARYLFNCGEGTQRLAHEHKTRLSRL 106

Query: 80  DSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVS 120
           + +F+TQ  W + GGL GL LTIQD GV +I LHGP  L S
Sbjct: 107 EQIFLTQNTWASCGGLPGLTLTIQDAGVRDIGLHGPPHLGS 147
Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity of nuclear and mitochondrial pre-tRNA. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA. May participate in tRNA processing in the developing embryo.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 2EC: 6EC: .EC: 1EC: 1
>sp|Q9BQ52|RNZ2_HUMAN Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens GN=ELAC2 PE=1 SV=2 Back     alignment and function description
>sp|Q9GL72|RNZ2_PANTR Zinc phosphodiesterase ELAC protein 2 OS=Pan troglodytes GN=ELAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9GL73|RNZ2_GORGO Zinc phosphodiesterase ELAC protein 2 OS=Gorilla gorilla gorilla GN=ELAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8HY87|RNZ2_MACFA Zinc phosphodiesterase ELAC protein 2 OS=Macaca fascicularis GN=ELAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q80Y81|RNZ2_MOUSE Zinc phosphodiesterase ELAC protein 2 OS=Mus musculus GN=Elac2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CGS5|RNZ2_RAT Zinc phosphodiesterase ELAC protein 2 OS=Rattus norvegicus GN=Elac2 PE=2 SV=1 Back     alignment and function description
>sp|P36159|RNZ_YEAST Ribonuclease Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRZ1 PE=1 SV=1 Back     alignment and function description
>sp|B2J3C7|RNZ_NOSP7 Ribonuclease Z OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rnz PE=3 SV=1 Back     alignment and function description
>sp|Q89ZN1|RNZ_BACTN Ribonuclease Z OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rnz PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
189240495 827 PREDICTED: similar to AGAP009743-PA [Tri 0.730 0.137 0.710 1e-41
328720986 804 PREDICTED: ribonuclease Z, mitochondrial 0.653 0.126 0.728 1e-37
357629817 800 putative zinc phosphodiesterase [Danaus 0.762 0.148 0.584 3e-37
261335993 928 putative zinc phosphodiesterase [Helicon 0.660 0.110 0.708 1e-36
443429427 736 Ribonuclease Z-like protein [Heliconius 0.660 0.139 0.708 2e-36
170041665 784 ribonuclease Z, mitochondrial [Culex qui 0.711 0.141 0.612 3e-36
157125937 783 zinc phosphodiesterase [Aedes aegypti] g 0.711 0.141 0.612 6e-36
158298629 797 AGAP009743-PA [Anopheles gambiae str. PE 0.711 0.139 0.621 2e-35
312373609 451 hypothetical protein AND_17209 [Anophele 0.711 0.246 0.612 2e-35
321472773 738 hypothetical protein DAPPUDRAFT_301666 [ 0.730 0.154 0.614 8e-35
>gi|189240495|ref|XP_968692.2| PREDICTED: similar to AGAP009743-PA [Tribolium castaneum] gi|270012571|gb|EFA09019.1| hypothetical protein TcasGA2_TC006728 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (81%)

Query: 5   KVMQHAQNLKFQRVKMREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEG 64
           K   H    + QR K++EK  KY PG V LQVLG+GA GAP+SLY+F+DQSRYLFNCGEG
Sbjct: 30  KEKTHIPEAQKQRRKIKEKFSKYSPGRVTLQVLGTGAEGAPRSLYVFSDQSRYLFNCGEG 89

Query: 65  TQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGL 118
           TQRLAHEHKMKLAKL+ +FIT+P W N+GGL G ALTIQDVGVPEI LHGP+GL
Sbjct: 90  TQRLAHEHKMKLAKLEHIFITRPTWANIGGLPGAALTIQDVGVPEITLHGPQGL 143

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328720986|ref|XP_001946795.2| PREDICTED: ribonuclease Z, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|357629817|gb|EHJ78358.1| putative zinc phosphodiesterase [Danaus plexippus] Back     alignment and taxonomy information
>gi|261335993|emb|CBH09273.1| putative zinc phosphodiesterase [Heliconius melpomene] Back     alignment and taxonomy information
>gi|443429427|gb|AGC92712.1| Ribonuclease Z-like protein [Heliconius erato] Back     alignment and taxonomy information
>gi|170041665|ref|XP_001848575.1| ribonuclease Z, mitochondrial [Culex quinquefasciatus] gi|167865235|gb|EDS28618.1| ribonuclease Z, mitochondrial [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157125937|ref|XP_001654456.1| zinc phosphodiesterase [Aedes aegypti] gi|108873466|gb|EAT37691.1| AAEL010336-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158298629|ref|XP_318827.4| AGAP009743-PA [Anopheles gambiae str. PEST] gi|157013976|gb|EAA14182.4| AGAP009743-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312373609|gb|EFR21319.1| hypothetical protein AND_17209 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|321472773|gb|EFX83742.1| hypothetical protein DAPPUDRAFT_301666 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
FB|FBgn0028426 766 JhI-1 "Juvenile hormone-induci 0.647 0.131 0.663 7.2e-32
ZFIN|ZDB-GENE-041111-227 865 elac2 "elaC homolog 2 (E. coli 0.628 0.113 0.489 9.6e-23
UNIPROTKB|I3L9W8 500 ELAC2 "Uncharacterized protein 0.660 0.206 0.448 1.3e-22
UNIPROTKB|Q9BQ52 826 ELAC2 "Zinc phosphodiesterase 0.576 0.108 0.5 3.6e-22
UNIPROTKB|E1BDK7 777 ELAC2 "Uncharacterized protein 0.576 0.115 0.511 4.6e-22
RGD|628882 827 Elac2 "elaC homolog 2 (E. coli 0.576 0.108 0.511 2.3e-21
UNIPROTKB|G3V6F5 827 Elac2 "Zinc phosphodiesterase 0.576 0.108 0.511 2.9e-21
MGI|MGI:1890496 831 Elac2 "elaC homolog 2 (E. coli 0.576 0.108 0.511 3e-21
UNIPROTKB|E2RHF6 821 ELAC2 "Uncharacterized protein 0.576 0.109 0.5 2.1e-20
TAIR|locus:2037430 890 TRZ3 "AT1G52160" [Arabidopsis 0.634 0.111 0.409 4.7e-15
FB|FBgn0028426 JhI-1 "Juvenile hormone-inducible protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 358 (131.1 bits), Expect = 7.2e-32, P = 7.2e-32
 Identities = 67/101 (66%), Positives = 80/101 (79%)

Query:    20 MREKSMKYVPGIVNLQVLGSGARGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKL 79
             +R+K    VPG VNLQVLGSGA GAP ++YLFTDQ+RYLFNCGEGTQRLAHEHK +L++L
Sbjct:    47 LRKKLASVVPGTVNLQVLGSGANGAPAAVYLFTDQARYLFNCGEGTQRLAHEHKTRLSRL 106

Query:    80 DSVFITQPVWENLGGLLGLALTIQDVGVPEINLHGPEGLVS 120
             + +F+TQ  W + GGL GL LTIQD GV +I LHGP  L S
Sbjct:   107 EQIFLTQNTWASCGGLPGLTLTIQDAGVRDIGLHGPPHLGS 147
GO:0016891 "endoribonuclease activity, producing 5'-phosphomonoesters" evidence=IMP
GO:0006388 "tRNA splicing, via endonucleolytic cleavage and ligation" evidence=IMP
GO:0005739 "mitochondrion" evidence=NAS
GO:0042779 "tRNA 3'-trailer cleavage" evidence=IDA
GO:0005634 "nucleus" evidence=NAS
GO:0001558 "regulation of cell growth" evidence=IMP
GO:0042780 "tRNA 3'-end processing" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
ZFIN|ZDB-GENE-041111-227 elac2 "elaC homolog 2 (E. coli)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3L9W8 ELAC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ52 ELAC2 "Zinc phosphodiesterase ELAC protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDK7 ELAC2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|628882 Elac2 "elaC homolog 2 (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6F5 Elac2 "Zinc phosphodiesterase ELAC protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1890496 Elac2 "elaC homolog 2 (E. coli)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHF6 ELAC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2037430 TRZ3 "AT1G52160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q80Y81RNZ2_MOUSE3, ., 1, ., 2, 6, ., 1, 10.51110.57690.1083yesN/A
Q8MKW7RNZ_DROME3, ., 1, ., 2, 6, ., 1, 10.66330.64740.1318yesN/A
Q8CGS5RNZ2_RAT3, ., 1, ., 2, 6, ., 1, 10.51720.55760.1051yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
pfam1369163 pfam13691, Lactamase_B_4, Family description 3e-19
COG1234 292 COG1234, ElaC, Metal-dependent hydrolases of the b 4e-10
TIGR02651 299 TIGR02651, RNase_Z, ribonuclease Z 7e-10
PRK00055 270 PRK00055, PRK00055, ribonuclease Z; Reviewed 3e-07
TIGR02649 303 TIGR02649, true_RNase_BN, ribonuclease BN 4e-05
>gnl|CDD|205867 pfam13691, Lactamase_B_4, Family description Back     alignment and domain information 
 Score = 75.7 bits (187), Expect = 3e-19
 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 35 QVLGSGARGAPK-SLYLFTDQSRYLF-NCGEGTQRLAHEHKMKLAKLDSVFITQPV-WEN 91
          QV+ +     P   L L  D  RYLF N GEGTQR  +E K++L+KL+ +F+T  V W N
Sbjct: 1  QVVTTPTADTPGPLLLLHFDSKRYLFGNVGEGTQRALNERKVRLSKLEDIFLTGKVSWSN 60

Query: 92 LGG 94
          +GG
Sbjct: 61 IGG 63

This is family of tRNase Z enzymes, that are closely related structurally to the Lactamase_B family members. tRNase Z is the endonuclease that is involved in tRNA 3'-end maturation through removal of the 3'-trailer sequences from tRNA precursors. The fission yeast Schizosaccharomyces pombe contains two candidate tRNase Zs encoded by two essential genes. The first is targeted to the nucleus and has an SV40 nuclear localisation signal at its N-terminus, consisting of four consecutive arginine and lysine residues between residues 208 and 211 (KKRK) that is critical for the NLS function. The second is targeted to the mitochondria, with an N-terminal mitochondrial targeting signal within the first 38 residues. Length = 63
>gnl|CDD|224155 COG1234, ElaC, Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>gnl|CDD|233963 TIGR02651, RNase_Z, ribonuclease Z Back     alignment and domain information
>gnl|CDD|234602 PRK00055, PRK00055, ribonuclease Z; Reviewed Back     alignment and domain information
>gnl|CDD|131697 TIGR02649, true_RNase_BN, ribonuclease BN Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 99.94
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 99.94
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 99.92
PRK02113252 putative hydrolase; Provisional 99.91
PRK05184 302 pyrroloquinoline quinone biosynthesis protein PqqB 99.91
PRK00055 270 ribonuclease Z; Reviewed 99.89
PRK11244 250 phnP carbon-phosphorus lyase complex accessory pro 99.86
TIGR02108 302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 99.85
PRK02126 334 ribonuclease Z; Provisional 99.76
TIGR03307 238 PhnP phosphonate metabolism protein PhnP. This fam 99.71
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.69
PRK04286 298 hypothetical protein; Provisional 99.66
PRK00685 228 metal-dependent hydrolase; Provisional 99.63
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.59
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 99.58
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 99.57
PF1369163 Lactamase_B_4: tRNase Z endonuclease 99.57
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 99.55
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 99.53
COG1235 269 PhnP Metal-dependent hydrolases of the beta-lactam 99.48
COG1237 259 Metal-dependent hydrolases of the beta-lactamase s 99.45
KOG2121|consensus 746 99.43
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 99.31
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 99.27
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 99.23
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 99.23
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 99.22
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 99.19
TIGR00361 662 ComEC_Rec2 DNA internalization-related competence 99.13
PLN02469 258 hydroxyacylglutathione hydrolase 99.11
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 99.09
PLN02398 329 hydroxyacylglutathione hydrolase 99.03
COG1782 637 Predicted metal-dependent RNase, consists of a met 99.02
PLN02962 251 hydroxyacylglutathione hydrolase 98.9
KOG1136|consensus 501 98.89
PRK11539 755 ComEC family competence protein; Provisional 98.89
COG2333 293 ComEC Predicted hydrolase (metallo-beta-lactamase 98.87
PF02112 335 PDEase_II: cAMP phosphodiesterases class-II; Inter 98.83
KOG2121|consensus 746 98.82
COG0491 252 GloB Zn-dependent hydrolases, including glyoxylase 98.82
KOG1137|consensus 668 98.81
COG2220 258 Predicted Zn-dependent hydrolases of the beta-lact 98.65
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 98.6
KOG0813|consensus 265 98.55
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 98.48
KOG1135|consensus 764 98.38
COG5212 356 PDE1 Low-affinity cAMP phosphodiesterase [Signal t 98.15
COG2248 304 Predicted hydrolase (metallo-beta-lactamase superf 97.82
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 96.89
KOG1361|consensus 481 96.71
PF14597199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 95.77
KOG3592|consensus 934 94.47
KOG0814|consensus 237 92.88
KOG4736|consensus302 91.08
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information 
Probab=99.94  E-value=1.3e-26  Score=186.21  Aligned_cols=121  Identities=28%  Similarity=0.414  Sum_probs=102.8

Q ss_pred             EEEEecCCC-----CCCcEEEEEEC----CeEEEEecCchHHHHHHHcCCCcCCcCeEEEcCCChhhhcChHHHHHHHhh
Q psy16255         34 LQVLGSGAR-----GAPKSLYLFTD----QSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQD  104 (156)
Q Consensus        34 l~~LGtg~~-----~~~~s~~I~~~----~~~iLiD~G~g~~~~l~~~~~~~~~i~~IfiTH~H~DHi~GL~~l~~~~~~  104 (156)
                      |+|||||++     ++.+|++|+.+    +..||||||+|+++++.+.++++.+|++|||||.|+||+.||+.|+.+++.
T Consensus         1 ~~~LGt~~~~p~~~r~~s~~lv~~~~~~~~~~iLiD~G~g~~~~l~~~~i~~~~id~IfiTH~H~DHi~Gl~~ll~~~~~   80 (303)
T TIGR02649         1 LIFLGTSAGVPTRTRNVTAILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKIFISHLHGDHLFGLPGLLCSRSM   80 (303)
T ss_pred             CEEEecCCCCCCCCCCccEEEEEccCCCCCCEEEEECCccHHHHHHHhCCCHHHCcEEEEeCCChhhcCCHHHHHHHHHh
Confidence            589999997     66799999864    378999999999999999999999999999999999999999999876654


Q ss_pred             CC-CCceEEEcCccc--ccc----------cceeeEEEcCCCCCeEeCCEEEEEEEcCCCCCC
Q psy16255        105 VG-VPEINLHGPEGL--VSE----------NMGLASNSISPSDPALIQARTLMKIPLRPRLPL  154 (156)
Q Consensus       105 ~~-~~~l~Iygp~~~--~l~----------~~~~~~~~~~~~~~~~~~~~~V~~~~~~H~~p~  154 (156)
                      .+ ..+++||||+++  +++          .+.+++++++++..+.+++++|+++|+.|++|+
T Consensus        81 ~~~~~~l~Iygp~~~~~~l~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~v~~~~~~H~~~~  143 (303)
T TIGR02649        81 SGIIQPLTIYGPQGIREFVETALRISGSWTDYPLEIVEIGAGEILDDGLRKVTAYPLEHPLEC  143 (303)
T ss_pred             cCCCCCeEEEechhHHHHHHHHHHhcccccCCceEEEEcCCCceEecCCeEEEEEEccCccce
Confidence            43 357999999987  222          135677888888888999999999999998764

Members of this protein family are ribonuclease BN of Escherichia coli K-12 and closely related proteins believed to be equivalent in function. Note that E. coli appears to lack RNase Z per se, and this protein of E. coli appears orthologous to (but not functionally equivalent to) RNase Z of Bacillus subtilis and various other species. Meanwhile, the yihY gene product of E. coli previously was incorrectly identified as RNase BN.
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>KOG2121|consensus Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>KOG1136|consensus Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>KOG2121|consensus Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>KOG0813|consensus Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>KOG1135|consensus Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1361|consensus Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>KOG3592|consensus Back     alignment and domain information
>KOG0814|consensus Back     alignment and domain information
>KOG4736|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3zwf_A 368 Crystal Structure Of Human Trnase Z, Short Form (El 2e-05
2cbn_A 306 Crystal Structure Of Zipd From Escherichia Coli Len 3e-04
2fk6_A 320 Crystal Structure Of Rnase ZTRNA(THR) COMPLEX Lengt 4e-04
1y44_A 320 Crystal Structure Of Rnase Z Length = 320 6e-04
>pdb|3ZWF|A Chain A, Crystal Structure Of Human Trnase Z, Short Form (Elac1). Length = 368 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 12/98 (12%)
Query: 32  VNLQVLGSGA------RGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFIT 85
           +++  LG+GA      RGA  ++ L  +   +LF+CGEGTQ    + ++K  ++  +FIT
Sbjct: 1   MDVTFLGTGAAYPSPTRGA-SAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFIT 59
Query: 86  QPVWENLGGLLGLALTI-----QDVGVPEINLHGPEGL 118
               ++  GL GL  TI       V    I ++GP GL
Sbjct: 60  HLHGDHFFGLPGLLCTISLQSGSMVSKQPIEIYGPVGL 97
>pdb|2CBN|A Chain A, Crystal Structure Of Zipd From Escherichia Coli Length = 306 Back     alignment and structure
>pdb|2FK6|A Chain A, Crystal Structure Of Rnase ZTRNA(THR) COMPLEX Length = 320 Back     alignment and structure
>pdb|1Y44|A Chain A, Crystal Structure Of Rnase Z Length = 320 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 2e-12
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 3e-09
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 5e-09
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 5e-08
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 2e-06
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Length = 368 Back     alignment and structure
 Score = 62.6 bits (152), Expect = 2e-12
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 33  NLQVLGSGA------RGAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQ 86
           ++  LG+GA      RGA  ++ L  +   +LF+CGEGTQ    + ++K  ++  +FIT 
Sbjct: 2   DVTFLGTGAAYPSPTRGAS-AVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITH 60

Query: 87  PVWENLGGLLGLALTIQDVGVP-----EINLHGPEGL 118
              ++  GL GL  TI            I ++GP GL
Sbjct: 61  LHGDHFFGLPGLLCTISLQSGSMVSKQPIEIYGPVGL 97
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Length = 320 Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Length = 306 Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Length = 280 Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Length = 268 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 99.93
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.92
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.91
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 99.9
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 99.88
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.88
3g1p_A 258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 99.84
2az4_A 429 Hypothetical protein EF2904; structural genomics, 99.76
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.76
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 99.75
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.72
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.69
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.69
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.66
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 99.66
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.65
3kl7_A235 Putative metal-dependent hydrolase; structural gen 99.63
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.62
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.62
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 99.6
1ztc_A221 Hypothetical protein TM0894; structural genomics, 99.6
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.58
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 99.55
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.55
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 99.52
3rpc_A 264 Possible metal-dependent hydrolase; structural gen 99.49
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 99.48
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.48
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 99.47
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 99.47
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 99.45
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.45
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.44
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 99.44
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 99.44
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 99.43
4efz_A 298 Metallo-beta-lactamase family protein; structural 99.43
3aj3_A 274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 99.43
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 99.43
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 99.41
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 99.41
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 99.4
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.4
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 99.39
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 99.39
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.37
3hnn_A 262 Putative diflavin flavoprotein A 5; PSI-2, protein 99.36
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 99.35
3r2u_A 466 Metallo-beta-lactamase family protein; structural 99.33
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 99.32
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 99.31
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 99.28
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 99.28
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 99.26
1p9e_A 331 Methyl parathion hydrolase; Zn containing; 2.40A { 99.26
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 99.25
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 99.21
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 99.2
1vjn_A 220 Zn-dependent hydrolase of metallo-beta-lactamase s 99.19
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 99.17
3esh_A 280 Protein similar to metal-dependent hydrolase; stru 99.16
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 99.13
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 99.13
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 99.07
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 99.06
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 98.94
2p97_A201 Hypothetical protein; putative metal-dependent hyd 98.92
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 98.83
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 98.72
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 98.58
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 97.86
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=8.7e-26  Score=184.62  Aligned_cols=123  Identities=26%  Similarity=0.373  Sum_probs=102.0

Q ss_pred             eEEEEEecCCC-----CCCcEEEEEECCeEEEEecCchHHHHHHHcCCCcCCcCeEEEcCCChhhhcChHHHHHHHhhCC
Q psy16255         32 VNLQVLGSGAR-----GAPKSLYLFTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTIQDVG  106 (156)
Q Consensus        32 m~l~~LGtg~~-----~~~~s~~I~~~~~~iLiD~G~g~~~~l~~~~~~~~~i~~IfiTH~H~DHi~GL~~l~~~~~~~~  106 (156)
                      |+|+|||||++     ++.+|++|+.++..+|||||+|+++++.+.++++.+|++|||||.|+||++|++.|+.++...+
T Consensus         1 M~l~~LGtg~~~p~~~r~~ss~ll~~~~~~iLiD~G~g~~~~l~~~~~~~~~id~I~iTH~H~DHi~gl~~l~~~~~~~~   80 (368)
T 3zwf_A            1 MDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITHLHGDHFFGLPGLLCTISLQS   80 (368)
T ss_dssp             CEEEEEECBSSSCCSSSCSSEEEEEETTEEEEECCCTTHHHHHHHSSSCGGGEEEEECCCSSGGGTTTHHHHHHHHHHHC
T ss_pred             CEEEEECCCCCCCCCCCCccEEEEEECCeEEEEeCChhHHHHHHHcCCChHHCCEEEECCCChHHhCcHHHHHHHhhhcc
Confidence            78999999996     4678999999999999999999999999999999999999999999999999999987765433


Q ss_pred             C-----CceEEEcCccc--ccc----------cceeeEEEcCC---------------------------C---------
Q psy16255        107 V-----PEINLHGPEGL--VSE----------NMGLASNSISP---------------------------S---------  133 (156)
Q Consensus       107 ~-----~~l~Iygp~~~--~l~----------~~~~~~~~~~~---------------------------~---------  133 (156)
                      +     .+++||||+++  +++          .+.+.++++.+                           +         
T Consensus        81 ~~~~~~~~l~iygp~~~~~~l~~~l~~~~~~~~~~~~~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~~~~  160 (368)
T 3zwf_A           81 GSMVSKQPIEIYGPVGLRDFIWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKEEQGRTILLDSEE  160 (368)
T ss_dssp             ------CCEEEEEETTHHHHHHHHHHHTTCCCSSCEEEEEECCCGGGSCC-------------------CCCEECCBTTT
T ss_pred             ccccCCCCeEEEEcHHHHHHHHHHHHhhCcCCCceEEEEEeecCccccccccccccccccccccCccccccccccccccc
Confidence            2     47999999998  332          13456666643                           2         


Q ss_pred             ---CCeEeCCEEEEEEEcCCCCCC
Q psy16255        134 ---DPALIQARTLMKIPLRPRLPL  154 (156)
Q Consensus       134 ---~~~~~~~~~V~~~~~~H~~p~  154 (156)
                         ..+++++++|+++|+.|++|+
T Consensus       161 ~~~~~~~~~~~~V~a~~~~H~vp~  184 (368)
T 3zwf_A          161 NSYLLFDDEQFVVKAFRLFHRIPS  184 (368)
T ss_dssp             TBEEEEECSSEEEEEEEEESSSCE
T ss_pred             CceeEEeCCCEEEEEEeccCCCce
Confidence               134568999999999999886
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d2cbna1 305 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Esch 2e-10
d2e7ya1 280 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Ther 4e-10
d1y44a1 307 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Baci 5e-10
d1zkpa1 244 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (B 2e-04
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: RNase Z-like
domain: Ribonuclease Z (RNase Z)
species: Escherichia coli [TaxId: 562]

 Score = 55.1 bits (131), Expect = 2e-10
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 12/96 (12%)

Query: 33  NLQVLGSGA------RGAPKSLYL----FTDQSRYLFNCGEGTQRLAHEHKMKLAKLDSV 82
           NL  LG+ A      R    ++ L     T    +LF+CGEGTQ           KLD +
Sbjct: 2   NLIFLGTSAGVPTRTRNVT-AILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKI 60

Query: 83  FITQPVWENLGGLLGLALTIQDVGVP-EINLHGPEG 117
           FI+    ++L GL GL  +    G+   + ++GP+G
Sbjct: 61  FISHLHGDHLFGLPGLLCSRSMSGIIQPLTIYGPQG 96
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Length = 280 Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Length = 307 Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 99.95
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 99.95
d1zkpa1 244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.92
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 99.87
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 99.77
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.76
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.66
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.63
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 99.52
d2aioa1 266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.42
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 99.36
d2gmna1 264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.35
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 99.33
d1k07a_ 262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 99.31
d1p9ea_ 294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 99.3
d1vmea2250 ROO-like flavoprotein TM0755, N-terminal domain {T 99.22
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 99.18
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 99.17
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 99.14
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.05
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.03
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.0
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 98.89
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 98.86
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 98.86
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 98.78
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 98.76
d1vjna_209 Hypothetical protein TM0207 {Thermotoga maritima [ 98.73
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 98.61
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 98.34
d2p97a1200 Hypothetical protein Ava3068 {Anabaena variabilis 98.11
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: RNase Z-like
domain: Ribonuclease Z (RNase Z)
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=1e-27  Score=186.67  Aligned_cols=123  Identities=28%  Similarity=0.422  Sum_probs=104.2

Q ss_pred             eEEEEEecCCC-----CCCcEEEEEE----CCeEEEEecCchHHHHHHHcCCCcCCcCeEEEcCCChhhhcChHHHHHHH
Q psy16255         32 VNLQVLGSGAR-----GAPKSLYLFT----DQSRYLFNCGEGTQRLAHEHKMKLAKLDSVFITQPVWENLGGLLGLALTI  102 (156)
Q Consensus        32 m~l~~LGtg~~-----~~~~s~~I~~----~~~~iLiD~G~g~~~~l~~~~~~~~~i~~IfiTH~H~DHi~GL~~l~~~~  102 (156)
                      |+|+||||||+     ++++|++|+.    ++..||||||+|++++|.+.++++.+|++|||||.|+||++||+.|+..+
T Consensus         1 m~l~~LGtg~~~p~~~r~~s~~li~~~~~~~~~~iL~DcG~g~~~~l~~~~~~~~~i~~IfiTH~H~DHi~Gl~~ll~~~   80 (305)
T d2cbna1           1 MNLIFLGTSAGVPTRTRNVTAILLNLQHPTQSGLWLFDCGEGTQHQLLHTAFNPGKLDKIFISHLHGDHLFGLPGLLCSR   80 (305)
T ss_dssp             CEEEEEECBSSSCCSSCCBCEEEEECCCSSCCCEEEECCCTTHHHHHHTSCCCTTTEEEEECSCCCHHHHTTHHHHHHHH
T ss_pred             CEEEEEccCCCCCCCCCccCEEEEEEecCCCCcEEEEeCchHHHHHHHHhCCCHHHCcEEEEccccHHHhCchhhhhhhh
Confidence            78999999997     5679999984    57889999999999999999999999999999999999999999998766


Q ss_pred             hhCC-CCceEEEcCccc--ccc----------cceeeEEEcCCCCCeEeCCEEEEEEEcCCCCCC
Q psy16255        103 QDVG-VPEINLHGPEGL--VSE----------NMGLASNSISPSDPALIQARTLMKIPLRPRLPL  154 (156)
Q Consensus       103 ~~~~-~~~l~Iygp~~~--~l~----------~~~~~~~~~~~~~~~~~~~~~V~~~~~~H~~p~  154 (156)
                      +..+ .+++.||||+++  +++          ...+++++......++.+.++|.+++..|.+++
T Consensus        81 ~~~~~~~~l~i~gP~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  145 (305)
T d2cbna1          81 SMSGIIQPLTIYGPQGIREFVETALRISGSWTDYPLEIVEIGAGEILDDGLRKVTAYPLEHPLEC  145 (305)
T ss_dssp             HHTTCCSCEEEEESTTHHHHHHHHHHHTTCCCSSCEEEEECCSEEEEECSSEEEEEEECBSSSCC
T ss_pred             hccCCcccccccCChhHHHHHHHHhhhhcccccccceeeecccccceeccceeEEeeeccccccc
Confidence            5544 458999999987  332          124566666666678889999999999999875
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure