Diaphorina citri psyllid: psy16256


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MLFGSPNDFPIVHAKHEEKSDSKSVYREYNREFLLPKGTNPESIKSSLSKDGVLTVEAPLPALGAPEKLIPIAH
cCEEECccEEEEEEEEEEECccccEEEEEEEEEEcccccccccEEECcccccEEEEEECccccccccCEEEECc
MLFGSPNDFPIVHAKHE******SVYREYNREFLLPKGTNPESIKSSLSKDGVLTVEA***********IPI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFGSPNDFPIVHAKHEEKSDSKSVYREYNREFLLPKGTNPESIKSSLSKDGVLTVEAPLPALGAPEKLIPIAH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0031430 [CC]M bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0031672, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009408 [BP]response to heatprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0010998 [BP]regulation of translational initiation by eIF2 alpha phosphorylationprobableGO:0080090, GO:0019222, GO:0051246, GO:0016310, GO:0031323, GO:0050789, GO:0044699, GO:0044267, GO:0051716, GO:0044260, GO:0010608, GO:2000112, GO:0071704, GO:0065007, GO:0031326, GO:0010468, GO:0006468, GO:0060255, GO:0006446, GO:0009987, GO:0009889, GO:0006464, GO:0050794, GO:0006950, GO:0036211, GO:0044763, GO:0008152, GO:0044238, GO:0032268, GO:0043555, GO:0019538, GO:0043558, GO:0050896, GO:0043412, GO:0044237, GO:0043170, GO:0006796, GO:0010556, GO:0033554, GO:0006793, GO:0006417, GO:0008150
GO:0010506 [BP]regulation of autophagyprobableGO:0009894, GO:0031329, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006497 [BP]protein lipidationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0009058, GO:0006464, GO:0043170, GO:0044249, GO:0043412, GO:0036211, GO:0008150, GO:0042157, GO:0034645, GO:1901576, GO:0042158, GO:0009059
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KLR, chain A
Confidence level:very confident
Coverage over the Query: 2-61
View the alignment between query and template
View the model in PyMOL