Diaphorina citri psyllid: psy16278


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MDSTSRSEVHRPKTSSKYTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWSPMKLE
ccccccccccEEEEEEccccccccccEEEEEccccccHHHHHHHHHHccccccEEEEEcccccccccccccccEEEEEcccccccccc
********VHRPKTSSKYTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWSPM***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSTSRSEVHRPKTSSKYTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWSPMKLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable helicase mot1 Regulates transcription in association with TATA binding protein (TBP). Removes TBP from the TATA box via its ATPase activity.confidentO43065
TATA-binding protein-associated factor MOT1 Regulates transcription in association with TATA binding protein (TBP). Removes TBP from the TATA box via its C-terminal ATPase activity. Both transcription activation and repression require its ATPase activity.confidentP32333
TATA-binding protein-associated factor 172 Regulates transcription in association with TATA binding protein (TBP). Removes TBP from the TATA box in an ATP-dependent manner.confidentO14981

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0097346 [CC]INO80-type complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0070603, GO:0043227, GO:0043226, GO:0044422
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MWY, chain W
Confidence level:very confident
Coverage over the Query: 6-87
View the alignment between query and template
View the model in PyMOL