Psyllid ID: psy16278

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MDSTSRSEVHRPKTSSKYTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWSPMKLE
ccccccccccEEEEEEccccccccccEEEEEccccccHHHHHHHHHHccccccEEEEEcccccccccccccccEEEEEcccccccccc
cccHHHHcccEEEEEEEcEEEEEcccEEEEEcccccHHHHHHHHHHHcccccEEEEEEEEcccccEEEEccccEEEEEEccccccccc
mdstsrsevhrpktsskyttcempgvtylrldgsvvSTARHAIVtkfnsdptIDVLLLTTQvgglglnltgadtvifvdhdwspmkle
mdstsrsevhrpktsskyttcempgvTYLRLDGSVVSTARHAIVtkfnsdptiDVLLLTTQVGGLGLNLTGADTVIFVDHdwspmkle
MDSTSRSEVHRPKTSSKYTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVlllttqvgglglnltgADTVIFVDHDWSPMKLE
*****************YTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDW******
********VHRPKTSSKYTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWSPM***
*****************YTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWSPMKLE
**S*S*SEVHRPKTSSKYTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSTSRSEVHRPKTSSKYTTCEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWSPMKLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
O43065 1953 Probable helicase mot1 OS yes N/A 0.727 0.032 0.781 2e-24
O14981 1849 TATA-binding protein-asso yes N/A 0.727 0.034 0.734 6e-24
P32333 1867 TATA-binding protein-asso yes N/A 0.715 0.033 0.730 5e-22
Q6CA87 1772 Helicase SWR1 OS=Yarrowia no N/A 0.681 0.033 0.55 5e-15
Q6FK48 1450 Helicase SWR1 OS=Candida no N/A 0.681 0.041 0.55 5e-14
Q59U81 1641 Helicase SWR1 OS=Candida N/A N/A 0.681 0.036 0.566 7e-14
Q6CJ38 1572 Helicase SWR1 OS=Kluyvero no N/A 0.681 0.038 0.55 9e-14
Q759G7 1486 Helicase SWR1 OS=Ashbya g no N/A 0.681 0.040 0.533 1e-13
Q9UR24 973 DNA repair protein rhp26 no N/A 0.715 0.064 0.539 3e-13
Q9NEL2 2395 Helicase ssl-1 OS=Caenorh no N/A 0.681 0.025 0.516 4e-13
>sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 Back     alignment and function desciption
 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (87%)

Query: 23   MPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDW 82
            MP VTY+RLDGSV  T R   VTKFN+DP+IDVLLLTT VGGLGLNLTGADTVIFV+HDW
Sbjct: 1761 MPDVTYMRLDGSVEPTKRQEAVTKFNNDPSIDVLLLTTHVGGLGLNLTGADTVIFVEHDW 1820

Query: 83   SPMK 86
            +PM+
Sbjct: 1821 NPMR 1824
Regulates transcription in association with TATA binding protein (TBP). Removes TBP from the TATA box via its ATPase activity.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 Back     alignment and function description
>sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 Back     alignment and function description
>sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 Back     alignment and function description
>sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 Back     alignment and function description
>sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 Back     alignment and function description
>sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=4 SV=1 Back     alignment and function description
>sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
91088413 1810 PREDICTED: similar to TATA-binding prote 0.727 0.035 0.812 5e-25
350421782 1872 PREDICTED: TATA-binding protein-associat 0.727 0.034 0.828 9e-25
340716725 1873 PREDICTED: TATA-binding protein-associat 0.727 0.034 0.828 9e-25
322799536 305 hypothetical protein SINV_13363 [Solenop 0.727 0.209 0.796 1e-24
157134957 1904 hypothetical protein AaeL_AAEL013189 [Ae 0.727 0.033 0.812 2e-24
332024392 1888 TATA-binding protein-associated factor 1 0.727 0.033 0.796 4e-24
242017388 1746 TATA-binding protein-associated factor, 0.727 0.036 0.781 4e-24
312371646 2134 hypothetical protein AND_21824 [Anophele 0.727 0.029 0.812 7e-24
347966667 2067 AGAP001820-PA [Anopheles gambiae str. PE 0.727 0.030 0.812 7e-24
78190607 429 SNF2 family DNA-dependent ATPase domain- 0.727 0.149 0.765 8e-24
>gi|91088413|ref|XP_966659.1| PREDICTED: similar to TATA-binding protein-associated factor 172 [Tribolium castaneum] gi|270011757|gb|EFA08205.1| hypothetical protein TcasGA2_TC005832 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 52/64 (81%), Positives = 61/64 (95%)

Query: 23   MPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDW 82
            MPGVTYLRLDGS+  + RH++VT+FN+DP+IDVLLLTTQVGGLGLNLTGADTVIFV+HDW
Sbjct: 1631 MPGVTYLRLDGSIPPSQRHSVVTRFNNDPSIDVLLLTTQVGGLGLNLTGADTVIFVEHDW 1690

Query: 83   SPMK 86
            +PMK
Sbjct: 1691 NPMK 1694

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350421782|ref|XP_003492955.1| PREDICTED: TATA-binding protein-associated factor 172-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716725|ref|XP_003396845.1| PREDICTED: TATA-binding protein-associated factor 172-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322799536|gb|EFZ20844.1| hypothetical protein SINV_13363 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|157134957|ref|XP_001663375.1| hypothetical protein AaeL_AAEL013189 [Aedes aegypti] gi|108870352|gb|EAT34577.1| AAEL013189-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|332024392|gb|EGI64590.1| TATA-binding protein-associated factor 172 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242017388|ref|XP_002429171.1| TATA-binding protein-associated factor, putative [Pediculus humanus corporis] gi|212514049|gb|EEB16433.1| TATA-binding protein-associated factor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|312371646|gb|EFR19778.1| hypothetical protein AND_21824 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347966667|ref|XP_321235.5| AGAP001820-PA [Anopheles gambiae str. PEST] gi|333469954|gb|EAA01172.6| AGAP001820-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|78190607|gb|ABB29625.1| SNF2 family DNA-dependent ATPase domain-containing protein [Priapulus caudatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
ZFIN|ZDB-GENE-021025-1 1861 btaf1 "BTAF1 RNA polymerase II 0.738 0.034 0.523 3.3e-13
DICTYBASE|DDB_G0286219 2005 DDB_G0286219 "putative TBP-ass 0.727 0.031 0.546 7.6e-13
UNIPROTKB|B4E0W6 677 BTAF1 "TATA-binding protein-as 0.727 0.094 0.5 1.3e-12
UNIPROTKB|F1NHJ5 1845 BTAF1 "Uncharacterized protein 0.738 0.035 0.492 1.8e-12
RGD|1564130 1848 Btaf1 "BTAF1 RNA polymerase II 0.727 0.034 0.5 3.4e-12
POMBASE|SPBC1826.01c 1953 mot1 "TATA-binding protein ass 0.727 0.032 0.546 4.1e-12
UNIPROTKB|F1N507 1845 Bt.112326 "Uncharacterized pro 0.727 0.034 0.5 4.9e-12
UNIPROTKB|I3LD21 1845 I3LD21 "Uncharacterized protei 0.727 0.034 0.5 4.9e-12
UNIPROTKB|O14981 1849 BTAF1 "TATA-binding protein-as 0.727 0.034 0.5 4.9e-12
UNIPROTKB|F1SCA0 1850 BTAF1 "Uncharacterized protein 0.727 0.034 0.5 4.9e-12
ZFIN|ZDB-GENE-021025-1 btaf1 "BTAF1 RNA polymerase II, B-TFIID transcription factor-associated" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 3.3e-13, P = 3.3e-13
 Identities = 34/65 (52%), Positives = 46/65 (70%)

Query:    22 EMPGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVXXXXXXXXXXXXXXXXADTVIFVDHD 81
             ++PGVTYLRLDGSV +  RH+IV++FN+DP+IDV                ADTV+FV+HD
Sbjct:  1678 QLPGVTYLRLDGSVQAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHD 1737

Query:    82 WSPMK 86
             W+PM+
Sbjct:  1738 WNPMR 1742
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
DICTYBASE|DDB_G0286219 DDB_G0286219 "putative TBP-associated factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|B4E0W6 BTAF1 "TATA-binding protein-associated factor 172" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHJ5 BTAF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1564130 Btaf1 "BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, (Mot1 homolog, S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
POMBASE|SPBC1826.01c mot1 "TATA-binding protein associated factor Mot1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1N507 Bt.112326 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LD21 I3LD21 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O14981 BTAF1 "TATA-binding protein-associated factor 172" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCA0 BTAF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P32333MOT1_YEAST3, ., 6, ., 4, ., -0.73010.71590.0337yesN/A
Q4IAK7SWR1_GIBZE3, ., 6, ., 4, ., 1, 20.550.68180.0354yesN/A
O43065MOT1_SCHPO3, ., 6, ., 4, ., -0.78120.72720.0327yesN/A
O14981BTAF1_HUMAN3, ., 6, ., 4, ., -0.73430.72720.0346yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 1e-14
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-13
smart0049082 smart00490, HELICc, helicase superfamily c-termina 8e-13
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 1e-11
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-09
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information 
 Score = 67.1 bits (163), Expect = 1e-14
 Identities = 31/62 (50%), Positives = 41/62 (66%)

Query: 25  GVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIFVDHDWSP 84
           G+ Y+RLDGS  +  R  ++ +FN+D    V LL+ + GGLGLNLTGADTVI  D  W+P
Sbjct: 735 GIKYVRLDGSTPAKRRQELIDRFNADEEEKVFLLSLKAGGLGLNLTGADTVILFDPWWNP 794

Query: 85  MK 86
             
Sbjct: 795 AV 796

Length = 866
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
KOG0384|consensus 1373 99.93
KOG0385|consensus 971 99.92
KOG0387|consensus 923 99.9
KOG0391|consensus 1958 99.9
KOG0392|consensus 1549 99.89
KOG0389|consensus941 99.89
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.88
KOG1002|consensus791 99.86
KOG0390|consensus776 99.85
KOG0388|consensus1185 99.82
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.78
KOG1015|consensus 1567 99.72
KOG0386|consensus 1157 99.72
KOG1000|consensus 689 99.69
KOG4439|consensus901 99.67
PRK04914 956 ATP-dependent helicase HepA; Validated 99.65
KOG1001|consensus674 99.58
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.44
KOG1016|consensus 1387 99.35
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.27
smart0049082 HELICc helicase superfamily c-terminal domain. 99.26
PRK13766 773 Hef nuclease; Provisional 99.25
KOG0331|consensus519 99.23
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.1
PTZ00110545 helicase; Provisional 99.09
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.07
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.06
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.03
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.03
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 98.99
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 98.96
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 98.96
KOG0330|consensus476 98.92
KOG0328|consensus400 98.89
KOG0333|consensus673 98.88
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.87
KOG0383|consensus696 98.83
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.83
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 98.82
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 98.79
PTZ00424401 helicase 45; Provisional 98.79
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.78
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.73
KOG0336|consensus629 98.66
KOG0345|consensus 567 98.62
KOG0347|consensus 731 98.62
PHA02558501 uvsW UvsW helicase; Provisional 98.6
KOG0348|consensus 708 98.58
KOG0335|consensus482 98.58
KOG0332|consensus477 98.53
KOG0344|consensus 593 98.53
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.52
KOG0341|consensus 610 98.42
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.4
KOG0338|consensus 691 98.37
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.37
PRK13767 876 ATP-dependent helicase; Provisional 98.33
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.31
KOG0340|consensus 442 98.29
TIGR00643630 recG ATP-dependent DNA helicase RecG. 98.28
KOG0342|consensus 543 98.26
PRK10689 1147 transcription-repair coupling factor; Provisional 98.19
KOG0350|consensus 620 98.18
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.16
KOG0298|consensus1394 98.13
KOG0327|consensus397 98.11
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.09
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.06
PRK05298 652 excinuclease ABC subunit B; Provisional 98.04
PRK09401 1176 reverse gyrase; Reviewed 98.03
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.02
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.01
KOG4284|consensus 980 98.01
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 97.99
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 97.94
KOG0354|consensus 746 97.93
KOG0326|consensus459 97.92
KOG0334|consensus 997 97.9
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 97.9
KOG0349|consensus 725 97.88
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 97.86
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 97.81
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 97.8
PRK14701 1638 reverse gyrase; Provisional 97.8
KOG0343|consensus 758 97.78
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.78
KOG0339|consensus 731 97.78
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 97.77
PHA02653 675 RNA helicase NPH-II; Provisional 97.61
KOG0953|consensus 700 97.52
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 97.47
KOG1123|consensus 776 97.33
PRK02362 737 ski2-like helicase; Provisional 97.32
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 97.32
PRK01172 674 ski2-like helicase; Provisional 97.18
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.08
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 96.98
PRK12904 830 preprotein translocase subunit SecA; Reviewed 96.91
PRK13107 908 preprotein translocase subunit SecA; Reviewed 96.89
KOG0346|consensus 569 96.75
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 96.66
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 96.55
COG1201 814 Lhr Lhr-like helicases [General function predictio 96.46
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.35
PRK09694 878 helicase Cas3; Provisional 96.31
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 96.23
PRK05580 679 primosome assembly protein PriA; Validated 96.16
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 95.96
PRK00254 720 ski2-like helicase; Provisional 95.76
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 95.0
KOG0337|consensus 529 94.62
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 94.36
PF13871 278 Helicase_C_4: Helicase_C-like 94.23
COG1202 830 Superfamily II helicase, archaea-specific [General 94.2
KOG0351|consensus 941 91.39
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 90.91
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 90.7
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 90.36
smart00492141 HELICc3 helicase superfamily c-terminal domain. 89.19
PF1262248 NpwBP: mRNA biogenesis factor 87.92
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 87.74
COG1205 851 Distinct helicase family with a unique C-terminal 85.67
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 85.28
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 83.91
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 82.46
KOG0352|consensus 641 81.66
smart00491142 HELICc2 helicase superfamily c-terminal domain. 81.42
COG4889 1518 Predicted helicase [General function prediction on 80.32
>KOG0384|consensus Back     alignment and domain information 
Probab=99.93  E-value=2.6e-26  Score=177.12  Aligned_cols=84  Identities=39%  Similarity=0.602  Sum_probs=78.4

Q ss_pred             cCccCCCceEEEEeecc--------cccCCCeEEEEECCCCHHHHHHHHHhccC-CCCCcEEEEeccccccccCCcCCCE
Q psy16278          4 TSRSEVHRPKTSSKYTT--------CEMPGVTYLRLDGSVVSTARHAIVTKFNS-DPTIDVLLLTTQVGGLGLNLTGADT   74 (88)
Q Consensus         4 ~~~~~g~k~liFs~~~~--------l~~~~~~~~~~~G~~~~~~R~~~v~~F~~-~~~~~v~lls~~~~~~Gl~L~~a~~   74 (88)
                      .+++.|||||||||.++        |..++++|.|+||+++.+.|+.+|++|+. +...+||||||+|||.||||+.|++
T Consensus       694 rLk~~GHrVLIFSQMVRmLDIL~eYL~~r~ypfQRLDGsvrgelRq~AIDhFnap~SddFvFLLSTRAGGLGINLatADT  773 (1373)
T KOG0384|consen  694 RLKEGGHRVLIFSQMVRMLDILAEYLSLRGYPFQRLDGSVRGELRQQAIDHFNAPDSDDFVFLLSTRAGGLGINLATADT  773 (1373)
T ss_pred             HHhcCCceEEEhHHHHHHHHHHHHHHHHcCCcceeccCCcchHHHHHHHHhccCCCCCceEEEEecccCcccccccccce
Confidence            46889999999999994        88999999999999999999999999998 5567789999999999999999999


Q ss_pred             EEEeCCCCCCCCC
Q psy16278         75 VIFVDHDWSPMKL   87 (88)
Q Consensus        75 vi~~d~~wnP~~~   87 (88)
                      ||++|.+|||+++
T Consensus       774 VIIFDSDWNPQND  786 (1373)
T KOG0384|consen  774 VIIFDSDWNPQND  786 (1373)
T ss_pred             EEEeCCCCCcchH
Confidence            9999999999864

>KOG0385|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PF12622 NpwBP: mRNA biogenesis factor Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 5e-23
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 3e-20
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 3e-16
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 2e-15
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-14
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 2e-07
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
 Score = 90.1 bits (224), Expect = 5e-23
 Identities = 24/65 (36%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 21  CEMPGVTYLRLDGSVVSTARHAIVTKFNSDPTID-VLLLTTQVGGLGLNLTGADTVIFVD 79
           C      Y+RLDG++    R  IV +FN+  + + + +L+++ GG GLNL GA+ ++  D
Sbjct: 436 CRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFD 495

Query: 80  HDWSP 84
            DW+P
Sbjct: 496 PDWNP 500
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.87
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.82
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.79
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.73
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.56
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.52
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.52
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.51
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.51
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.5
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.49
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.48
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.48
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.45
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.43
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.42
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.13
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.42
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.33
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.3
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.27
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.2
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.18
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.14
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.14
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.12
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.09
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.09
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.07
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.06
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.05
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.05
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.99
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.97
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.97
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.95
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 98.94
3h1t_A590 Type I site-specific restriction-modification syst 98.86
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.83
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.77
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.53
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.47
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 98.44
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.43
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.43
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.22
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.16
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.16
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.15
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.11
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.0
3jux_A 822 Protein translocase subunit SECA; protein transloc 97.97
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.93
1yks_A 440 Genome polyprotein [contains: flavivirin protease 97.87
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 97.84
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.81
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 97.79
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 97.77
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.73
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 97.67
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.66
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 97.66
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.63
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 97.61
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 97.56
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 97.49
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 96.89
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 93.44
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 92.76
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 90.1
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 86.03
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 83.13
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
Probab=99.87  E-value=9.6e-23  Score=138.14  Aligned_cols=81  Identities=27%  Similarity=0.510  Sum_probs=74.3

Q ss_pred             cCCCceEEEEeecc--------ccc-CCCeEEEEECCCCHHHHHHHHHhccCCCCCcEEEEeccccccccCCcCCCEEEE
Q psy16278          7 SEVHRPKTSSKYTT--------CEM-PGVTYLRLDGSVVSTARHAIVTKFNSDPTIDVLLLTTQVGGLGLNLTGADTVIF   77 (88)
Q Consensus         7 ~~g~k~liFs~~~~--------l~~-~~~~~~~~~G~~~~~~R~~~v~~F~~~~~~~v~lls~~~~~~Gl~L~~a~~vi~   77 (88)
                      ++|+|+||||+|..        |.. .|+++..++|+++.++|++++++|++++.+.|+|+++++||+||||++|++||+
T Consensus       110 ~~~~kvlIFs~~~~~~~~l~~~L~~~~g~~~~~l~G~~~~~~R~~~i~~F~~~~~~~v~L~st~~~g~Glnl~~a~~VI~  189 (271)
T 1z5z_A          110 DEGDKIAIFTQFVDMGKIIRNIIEKELNTEVPFLYGELSKKERDDIISKFQNNPSVKFIVLSVKAGGFGINLTSANRVIH  189 (271)
T ss_dssp             HTTCCEEEEESCHHHHHHHHHHHHHHHCSCCCEECTTSCHHHHHHHHHHHHHCTTCCEEEEECCTTCCCCCCTTCSEEEE
T ss_pred             hCCCeEEEEeccHHHHHHHHHHHHHhcCCcEEEEECCCCHHHHHHHHHHhcCCCCCCEEEEehhhhcCCcCcccCCEEEE
Confidence            37899999999983        444 389999999999999999999999998788899999999999999999999999


Q ss_pred             eCCCCCCCCC
Q psy16278         78 VDHDWSPMKL   87 (88)
Q Consensus        78 ~d~~wnP~~~   87 (88)
                      +|++|||+.+
T Consensus       190 ~d~~wnp~~~  199 (271)
T 1z5z_A          190 FDRWWNPAVE  199 (271)
T ss_dssp             CSCCSCTTTC
T ss_pred             ECCCCChhHH
Confidence            9999999875
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-05
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]

 Score = 38.7 bits (89), Expect = 2e-05
 Identities = 16/73 (21%), Positives = 26/73 (35%), Gaps = 10/73 (13%)

Query: 21  CEMPGVTYLRLDGSVVSTARH--------AIVTKFNSDPTIDVLLLTTQVGGLGLNLTGA 72
               G+   R  G                 I+ +F      +VL+  T VG  GL++   
Sbjct: 181 LVKDGIKAKRFVGQASKENDRGLSQREQKLILDEFARG-EFNVLV-ATSVGEEGLDVPEV 238

Query: 73  DTVIFVDHDWSPM 85
           D V+F +   S +
Sbjct: 239 DLVVFYEPVPSAI 251

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.87
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.87
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.6
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.57
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.56
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.54
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.53
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.5
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.48
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.46
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.36
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.28
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.23
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.05
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 98.41
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.19
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.12
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.69
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 97.5
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 96.43
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 95.85
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 82.89
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=99.87  E-value=1.2e-23  Score=145.37  Aligned_cols=82  Identities=33%  Similarity=0.628  Sum_probs=74.4

Q ss_pred             ccCCCceEEEEeecc--------cccCCCeEEEEECCCCHHHHHHHHHhccCCC-CCcEEEEeccccccccCCcCCCEEE
Q psy16278          6 RSEVHRPKTSSKYTT--------CEMPGVTYLRLDGSVVSTARHAIVTKFNSDP-TIDVLLLTTQVGGLGLNLTGADTVI   76 (88)
Q Consensus         6 ~~~g~k~liFs~~~~--------l~~~~~~~~~~~G~~~~~~R~~~v~~F~~~~-~~~v~lls~~~~~~Gl~L~~a~~vi   76 (88)
                      ..+|+|+||||+|..        |...|+++.+++|+++..+|+++++.|+++. ...|||+++++||.||||+.|++||
T Consensus       115 ~~~g~KvlIFs~~~~~ld~l~~~l~~~g~~~~~l~G~~~~~~R~~~i~~F~~~~~~~~vlLls~~agg~GlnL~~a~~vi  194 (346)
T d1z3ix1         115 TTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLV  194 (346)
T ss_dssp             HHCCCEEEEEESCHHHHHHHHHHHHHHTCCEEEECSSCCHHHHHHHHHHHHSTTCCCCEEEEEGGGSCTTCCCTTEEEEE
T ss_pred             HhcCCceeEEeehhhhhHHHHHHHhhhhccccccccchhHHHHHHHHHhhhcccccceeeeecchhhhhccccccceEEE
Confidence            357899999999983        6778999999999999999999999999854 4568999999999999999999999


Q ss_pred             EeCCCCCCCCC
Q psy16278         77 FVDHDWSPMKL   87 (88)
Q Consensus        77 ~~d~~wnP~~~   87 (88)
                      ++||+|||+.+
T Consensus       195 ~~d~~wnp~~~  205 (346)
T d1z3ix1         195 MFDPDWNPAND  205 (346)
T ss_dssp             ECSCCSSHHHH
T ss_pred             EecCCCccchH
Confidence            99999999864
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure