Diaphorina citri psyllid: psy16286

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MAGSTNNVHNNVGFLKTVNRVCVALSRAKQGLFIMGNMKCLSADSQLWQEIKNKLVTRRSINESFRLQCNKHRAVTIIRAVEDFEACCCLTV
ccCECccccccEEEEEcccHHHHHHHHccccEEEEEcHHHHccccHHHHHHHHHHHHcccccccccEEccccccEEEEcccccccccccccc
MAGSTN*VHNNVGFLKTVNRVCVALSRAKQGLFIMGNMKCLSADSQLWQEIKNKLVTRRSINESFRLQCNKHRAVTIIRAVEDFEACCCLT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGSTNNVHNNVGFLKTVNRVCVALSRAKQGLFIMGNMKCLSADSQLWQEIKNKLVTRRSINESFRLQCNKHRAVTIIRAVEDFEACCCLTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004386 [MF]helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GK6, chain A
Confidence level:very confident
Coverage over the Query: 1-64
View the alignment between query and template
View the model in PyMOL