Has a role in the RNA interference (RNAi) pathway which is important for heterochromatin formation and accurate chromosome segregation. A member of the RNA-directed RNA polymerase complex (RDRC) which is involved in the generation of small interfering RNAs (siRNAs) and mediate their association with the RNA-induced transcriptional silencing (RITS) complex. RITS acts as a priming complex for dsRNA synthesis at the site of non-coding centromeric RNA.
Probable RNA helicase, which may be involved in modulation of the translation termination process. Probably unwinds double-stranded RNA. In vitro, unwinds covalently closed, circular DNA in the presence of a DNA topoisomerase TOP1 and replication factor-A protein RFA1.
Score = 43.5 bits (101), Expect = 3e-04, Method: Composition-based stats.
Identities = 26/73 (35%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
Query: 10 NNVGFLKTVNRVCVALSRAKQGLFIMGNMKCLSADSQLWQEIKNKLVTRRSINESFRLQC 69
+ +GFL+ R+ VAL+RA+ L I+GNM+ L D LW + + ++R+ + ES +
Sbjct: 1589 HGIGFLRDFRRLNVALTRARSSLLIIGNMETLKTDD-LWGSLVDDALSRKLV-ESPHID- 1645
Query: 70 NKHRAVTIIRAVE 82
++ R +TI R E
Sbjct: 1646 SEGRLITISRTSE 1658
ATP-dependent 5'->3' DNA/RNA helicase required for the expression and maturation of diverse classes of non-protein-coding RNAs like precursor tRNAs, rRNAs and small nuclear (snRNA) and nucleolar (snoRNA) RNAs. Directs RNA polymerase II transcription termination on snoRNAs as well as on several short protein-coding genes. May also play a role in transcription-coupled nucleotide excision repair.
Score = 43.1 bits (100), Expect = 5e-04, Method: Composition-based stats.
Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
Query: 1 MAGSTNNVHNNVGFLKTVNRVCVALSRAKQGLFIMGNMKCLSADSQLWQEIKNKLVTRRS 60
M+ +N +GFL R+ VAL+RAK G+ I+GN K L A QLW + N R+
Sbjct: 819 MSCVRSNERQGIGFLNDPRRLNVALTRAKFGIIIVGNPKVL-AKQQLWNHLLNFYKDRKV 877
Query: 61 INE 63
+ E
Sbjct: 878 LVE 880
RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. The formation of an Upf1-Upf2-Upf3 surveillance complex is believed to activate NMD.
Score = 43.1 bits (100), Expect = 5e-04, Method: Composition-based stats.
Identities = 24/77 (31%), Positives = 47/77 (61%), Gaps = 8/77 (10%)
Query: 6 NNVHNNVGFLKTVNRVCVALSRAKQGLFIMGNMKCLSADSQLWQEIKNKLVTRRSINESF 65
N++ ++GFL ++ R+ V ++RAK LFI+G+++ L ++Q W ++ R +I ++
Sbjct: 2393 NSIQGSIGFLASLQRLNVTITRAKYSLFILGHLRTL-MENQHWNQLIQDAQKRGAIIKT- 2450
Query: 66 RLQCNK---HRAVTIIR 79
C+K H AV I++
Sbjct: 2451 ---CDKNYRHDAVKILK 2464
Probable helicase, which may be involved in RNA maturation (By similarity). Involved in DNA double-strand breaks damage response generated by oxidative stress.
Score = 43.1 bits (100), Expect = 5e-04, Method: Composition-based stats.
Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
Query: 7 NVHNNVGFLKTVNRVCVALSRAKQGLFIMGNMKCLSADSQLWQEIKNKLVTRRSINE 63
N H +GFL R+ VAL+RAK G+ I+GN K LS LW + N ++ + E
Sbjct: 825 NEHQGIGFLNDPRRLNVALTRAKYGVIIVGNPKALSKQP-LWNNLLNNYKEQKVLVE 880
RNA-dependent helicase and ATPase required for nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Is recruited to mRNAs upon translation termination and undergoes a cycle of phosphorylation and dephosphorylation; its phosphorylation appears to be a key step in NMD. The formation of an rent1-rent2-rent3 surveillance complex is believed to activate NMD.
Takifugu rubripes (taxid: 31033)
EC: 3
EC: .
EC: 6
EC: .
EC: 4
EC: .
EC: -
Close Homologs in the Non-Redundant Database Detected by BLAST
>gi|189238133|ref|XP_001814326.1| PREDICTED: similar to NFX1-type zinc finger-containing protein 1 [Tribolium castaneum] gi|270008819|gb|EFA05267.1| hypothetical protein TcasGA2_TC015422 [Tribolium castaneum]
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 195
>gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair]
AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species [DNA metabolism, DNA replication, recombination, and repair]. Length = 1230
>gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative
The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases [DNA metabolism, DNA replication, recombination, and repair]. Length = 637
The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases.
Some of the members are found in positive-strand single stranded RNA viruses. The helicase has multiple roles at different stages of viral RNA replication, as dissected by mutational analysis [].; GO: 0004386 helicase activity
AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species.
AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the alphaproteobacteria (as modeled here) and the Firmicutes, while the partner AddB proteins show no strong homology across the two groups of species.
>TIGR01448 recD_rel helicase, putative, RecD/TraA family
This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD.
This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. A related family in the Gram-positive bacteria separates in a phylogenetic tree, has an additional N-terminal extension of about 200 residues, and is not supported as a member of a RecBCD complex by neighboring genes. The related family is consequently described by a different model.
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]
