Diaphorina citri psyllid: psy16296

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70

MFELGRELYARFSYGYELLIFLVALPMNQKHLKNQHVRVYKGSIDCMLQTIKHEGFMALYKGFIPTWFIL

ccHHHHHHHHHHHHHHHHHHHccccccHHcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccc

*FELGRELYARFSYGYELLIFLVALPMNQKHLKNQHVRVYKGSIDCMLQTIKHEGFMALYKGFIPTWFIL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFELGRELYARFSYGYELLIFLVALPMNQKHLKNQHVRVYKGSIDCMLQTIKHEGFMALYKGFIPTWFIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Kidney mitochondrial carrier protein 1	Probable transporter.	confident	Q9CR58
Kidney mitochondrial carrier protein 1	Probable transporter.	confident	Q5XGI1
Mitochondrial oxaloacetate transport protein	Transports oxaloacetate and sulfate.	confident	P32332

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0015729 [BP]	oxaloacetate transport	probable	GO:0051234, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0006820, GO:0006835, GO:0071702, GO:0008150, GO:0015740, GO:0051179, GO:0044699, GO:0046942
GO:0008271 [MF]	secondary active sulfate transmembrane transporter activity	probable	GO:0022891, GO:0015075, GO:1901682, GO:0015291, GO:0005215, GO:0008509, GO:0015116, GO:0022857, GO:0022892, GO:0003674, GO:0015103, GO:0022804
GO:0008272 [BP]	sulfate transport	probable	GO:0006811, GO:0006810, GO:0072348, GO:0044765, GO:0006820, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0034659 [BP]	isopropylmalate transport	probable	GO:0015718, GO:0015850, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0044765, GO:0006835, GO:0071702, GO:0008150, GO:0051234, GO:0006820, GO:0044699, GO:0046942
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0005740 [CC]	mitochondrial envelope	probable	GO:0031967, GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0031975, GO:0044446, GO:0044444, GO:0044429, GO:0005575, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0034658 [MF]	isopropylmalate transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005310, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0005215, GO:0046943
GO:0050789 [BP]	regulation of biological process	probable	GO:0008150, GO:0065007
GO:0000227 [MF]	oxaloacetate secondary active transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0015291, GO:0008514, GO:0015131, GO:0008509, GO:0005215, GO:0015075, GO:0022857, GO:0003674, GO:0022804, GO:0005310, GO:0005342, GO:0046943

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 8-69
View the alignment between query and template
View the model in PyMOL