Diaphorina citri psyllid: psy1629


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MNCVRWVRPGNNFNPGFQFFHKIQVNGENEHPLYTFLKSSCPPTRDGYRTPVTDLYYRPVRVSDVRWNFEKFLVDHR
cccEEEECccccccccCEcEEEEEECcccccHHHHHHHHcccccccccccccccccccccccccEEEEcEEEEEccc
*NCVRWVRPGNNFNPGFQFFHKIQVNGENEHPLYTFLKSSCPPTRDGYRTPVTDLYYRPVRVSDVRWNFEKFLVDHR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNCVRWVRPGNNFNPGFQFFHKIQVNGENEHPLYTFLKSSCPPTRDGYRTPVTDLYYRPVRVSDVRWNFEKFLVDHR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutathione peroxidase 3 Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.confidentP37141
Glutathione peroxidase 3 Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.confidentP22352
Glutathione peroxidase 3 Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.confidentP23764

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0070013 [CC]intracellular organelle lumenprobableGO:0005575, GO:0043233, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0043229, GO:0005623, GO:0044424, GO:0043226, GO:0044422
GO:0010035 [BP]response to inorganic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0006749 [BP]glutathione metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0006518, GO:0044281
GO:0043295 [MF]glutathione bindingprobableGO:1901681, GO:0043168, GO:0042277, GO:0072341, GO:1900750, GO:0031406, GO:0043167, GO:0003674, GO:0005488, GO:0033218, GO:0016597
GO:0004602 [MF]glutathione peroxidase activityprobableGO:0016209, GO:0003824, GO:0003674, GO:0016684, GO:0004601, GO:0016491
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008430 [MF]selenium bindingprobableGO:0003674, GO:0005488
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I3Y, chain A
Confidence level:very confident
Coverage over the Query: 5-77
View the alignment between query and template
View the model in PyMOL