Diaphorina citri psyllid: psy16306

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
QFQEIHVQLCSPEQLQPKPEVSQLKFGTVFTDHMLQIEFNEQLGGWQAPRVSPLKYLTLHPAAKVLHYSVELFEGMKAYRGVDGHIRMFRPEMNMDRMNRSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGTDLFEGMKAYRGVDGHIRMFRPEMNMDRMNQSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGTDLFEGMKAYRGVDGHIRMFRPEMNMDRMNRSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGTD
ccccCEEEECccccccccccccccccccccccEEEEEEECcccccccccEEEcccccccccccHHHHHHHHHHccccccccccccEEEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccEEEEccEEEEcccccccccccccccEEEEEcccccHHHHHHcHHccccccccHHHHHHHHHHHHHccccccccccccccEEcccccccccccccccccccccEEEEEcccccHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccEEEEccccEEcc
***EIHV***************QLKFGTVFTDHMLQIEFNEQLGGWQAPRVSPLKYLTLHPAAKVLHYSVELFEGMKAYRGVDGHIRMFRPEMNMDRMNRSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGTDLFEGMKAYRGVDGHIRMFRPEMNMDRMNQSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGTDLFEGMKAYRGVDGHIRMFRPEMNMDRMNRSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QFQEIHVQLCSPEQLQPKPEVSQLKFGTVFTDHMLQIEFNEQLGGWQAPRVSPLKYLTLHPAAKVLHYSVELFEGMKAYRGVDGHIRMFRPEMNMDRMNRSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGTDLFEGMKAYRGVDGHIRMFRPEMNMDRMNQSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGTDLFEGMKAYRGVDGHIRMFRPEMNMDRMNRSALRAGLPQFDPEEMIQCLNRLIQIDQEWVPHTTAASLYIRPTLIGTD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Branched-chain-amino-acid aminotransferase, cytosolic Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.confidentP54688
Branched-chain-amino-acid aminotransferase, cytosolic Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.confidentP54690
Branched-chain-amino-acid aminotransferase, cytosolic Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. Catalyzes the formation of methionine from 2-keto-4-methylthiobutyrate (KMTB) in the methionine salvage pathway primarily using branched chain amino acids (leucine, isoleucine, and valine) as well as lysine and proline as the amino donors. Involved in cell cycle regulation.confidentP47176

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004084 [MF]branched-chain-amino-acid transaminase activityprobableGO:0008483, GO:0016740, GO:0003674, GO:0016769, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009098 [BP]leucine biosynthetic processprobableGO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0044238, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0008652, GO:1901564, GO:1901566, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0006551, GO:0009081, GO:0009082
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009083 [BP]branched-chain amino acid catabolic processprobableGO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0044282, GO:0044712, GO:1901575, GO:0006520, GO:0071704, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237, GO:0009081

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2COI, chain A
Confidence level:very confident
Coverage over the Query: 2-156
View the alignment between query and template
View the model in PyMOL
Template: 2COI, chain A
Confidence level:very confident
Coverage over the Query: 199-301
View the alignment between query and template
View the model in PyMOL
Template: 2A1H, chain A
Confidence level:very confident
Coverage over the Query: 123-295
View the alignment between query and template
View the model in PyMOL