Diaphorina citri psyllid: psy16319

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MTLMRDQMQYSTLFDLASSCSSLQDPYLDVAEAQTYELSACYNVSIDCRSGDMVARIKTNKLFDGKIYAKGSPNSCVQDIKGSLDFELEMAFDDVECNVKHQGLGRYMNDVVIQHHDTIITSSDLGLAVTCQYDLTNKTVSNEVDLGVQGDVKSALTEEVVVDSPNVAMKITDRSGADVKPSAEVGDPLALRFEILDPNSPYEIFVRELVAMDGVDSSEIVLIDSNGCPTDHFIMGPLYKAADTGK
cccccccccEEEEEEccccccccccccccccccccEEcccEEcEEEEEcccEEEEEEEcccccCEEEEEcccccccEEcccccEEEEEEEECccccccCECcccCEEEEEEEEEEccccccccccEEEEEEEEcccccEEccEEEEECccccccccEEEEECccccCEEEEEcccccccccEEEcccEEEEEEEECcccccccEEEEEEEEEccccccEEEEEcccccccccccccccCCcccccc
********QYSTLFDLASSCSSLQDPYLDVAEAQTYELSACYNVSIDCRSGDMVARIKTNKLFDGKIYAKGSPNSCVQDIKGSLDFELEMAFDDVECNVKHQGLGRYMNDVVIQHHDTIITSSDLGLAVTCQYDLTNKTVSNEVDLGVQGDVKSALTEEVVVDSPNVAMKI*****ADVKPSAEVGDPLALRFEILDPNSPYEIFVRELVAMDGVDSSEIVLIDSNGCPTDHFIMGPLYK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLMRDQMQYSTLFDLASSCSSLQDPYLDVAEAQTYELSACYNVSIDCRSGDMVARIKTNKLFDGKIYAKGSPNSCVQDIKGSLDFELEMAFDDVECNVKHQGLGRYMNDVVIQHHDTIITSSDLGLAVTCQYDLTNKTVSNEVDLGVQGDVKSALTEEVVVDSPNVAMKITDRSGADVKPSAEVGDPLALRFEILDPNSPYEIFVRELVAMDGVDSSEIVLIDSNGCPTDHFIMGPLYKAADTGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016476 [BP]regulation of embryonic cell shapeprobableGO:0022604, GO:0051239, GO:0022603, GO:0050793, GO:0051128, GO:0008150, GO:0008360, GO:2000026, GO:0045995, GO:0065007, GO:0065008, GO:0050789, GO:0050794
GO:0003383 [BP]apical constrictionprobableGO:0030154, GO:0048468, GO:0006928, GO:0003382, GO:0009653, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0030855, GO:0002064, GO:0032502, GO:0009987, GO:0030029, GO:0060429, GO:0009888, GO:0044767, GO:0030048, GO:0044763, GO:0048856, GO:0008150, GO:0070252

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NK4, chain A
Confidence level:confident
Coverage over the Query: 44-134,147-235
View the alignment between query and template
View the model in PyMOL