Diaphorina citri psyllid: psy16327

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990----

MEMTDDHYQLAQIIEIWKLIAKEALSNVVVSNEVVKKLCFTTKNMRFDFYPRLMTEWRMTRGIEEQTKAFLDGFNEVVPIEWLKYFDERELELILCGMQEIDVEDWQRNAIYRHYTRNSKQTTRVVKNTYQPKWNEEFTVGGQGGGLLKPNPYIELYVDYKNPKTTRVVKNTYQPKWNEEFTVLVSPYSIILFRLLDHRTFRRDCTIGEKRLNIYGVLAHYNGKCEHLEITLDLMNDSRVSPPLMSVEMPPLLRNNTPHAASPLAQANTDVVVSHRSVLNEGIRARSRPPGSENTACPPPPHHNHSSPSISSSQQQHTQVSNGAVQCTSSSSSSSAALPPIDLAQEAGASGGTTSPRAAQSNGLPPALPPEEPLPPGWEIRQDTYGRRYYVDHNTRSSSWERPQPLPPGWELRRDPRGRVYYVDHNTRSTTWQRPNSERLQHFKHWQGERAHVVSQGSQRFLYPQHGVGVSSSSAVSFSTGVTEEDADTYGRRYYVDHNTRSSSWERPQPLPPGWELRRDPRGRVYYVDHNTRSTTWQRPNSERLQHFKHWQGERAHVVSQGSQRFLYPQHGVGVSSSSAVSFSTGVTEEDDALGSLPSGWERRVQPDGRVYFVNHKNRTTQWEDPRTQGQEIGQIGADEPPLPPGWEIRYTEDGTRYFVDHNTRSTTFEDPRPGVPKDQKGAYGVPKAYERSFRWKLSQFRYLCHHNVLPSHIKITVARQTLFEDSYHQVMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLLYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLVMKDIESIDPEFYNSLVWIRDNNIDECGLELYLSVDFEILGQVIHHELKENGDKIRVCEENKEEYMRWYGSGSSCERAIVRREPVCFSSLPGHAVFPWEDLPNSWRFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYDQMVEKLNYAIEETEGFGQE

ccccccccccccEEEEEEEEEEcccccEEEEcccccccEEEccccccccHHHHHHEEEEHHHHHHHHHHHHHcccccccHHHHccccHHHHHHHHcccccccHHHHHHHccccccccccccccEEEEccccccccccEEcccccccccccccEEEEEEcccccCEEEEEccccccccccEEEEEEccccEEEEEEEcccccccccCEEEEEEEcccccccccccccEEEEEEEccccccccccccEEEcccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHcccHHHHccEEEEEEccccccccccHHHHHHHHHHccccccccccEEECcccccCEEEcccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHccccccccHHHcccHHHHHHHHHHHcccccccccEEEEEEEEEEcccEEEEEcccccccccccccHHHHHHHHHHcccccHHHHHHHHccccccccccccccccccccHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccc

MEMTDDHYQLAQIIEIWKLIAKEALSNVVVSNEVVKKLCFTTKNMRFDFYPRLMTEWRMTRGIEEQTKAFLDGFNEVVPIEWLKYFDERELELILCGMQEIDVEDWQRNAIYRHYTRNSKQTTRVVKNTYQPKWNEEFTVGGQGGGLLKPNPYIELYVDYKNPKTTRVVKNTYQPKWNEEFTVLVSPYSIILFRLLDHRTFRRDCTIGEKRLNIYGVLAHYNGKCEHLEITLDLM**********************************************************************************************************************************************WEIRQDTYGRRYYVD*************************GRVYY**HNTR************************************************************TYGRRYYVD*************************GRVYYVDHNTRSTTW*******LQHFK*W*GER*HV******************************************WERRVQPDGRVYFVNHKNRT*************************GWEIRYTEDGTRYFVDHNTR*****************AYGVPKAYERSFRWKLSQFRYLCHHNVLPSHIKITVARQTLFEDSYHQVMRLPAYELRRRLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQINPASYVNPDHLLYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLVMKDIESIDPEFYNSLVWIRDNNIDECGLELYLSVDFEILGQVIHHELKENGDKIRVCEENKEEYMRWYGSGSSCERAIVRREPVCFSSLPGHAVFPWEDLPNSWRFCIEKVGKDTWLPRSHTCFNRLDLPPYKSYDQMVEKLNYAIEETEGFG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase Su(dx)	E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Down-regulates Notch/N signaling pathway, probably by promoting Notch ubiquitination, endocytosis and degradation. Involved in wing growth and leg joint formation.	confident	Q9Y0H4
NEDD4-like E3 ubiquitin-protein ligase WWP2	E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Polyubiquitinates POU5F1 by 'Lys-63'-linked conjugation and promotes it to proteasomal degradation; in embryonic stem cells (ESCs) the ubiquitination is proposed to regulate POU5F1 protein level. Ubiquitinates EGR2 and promotes it to proteasomal degradation; in T-cells the ubiquitination inhibits activation-induced cell death. Ubiquitinates SLC11A2; the ubiquitination is enhanced by presence of NDFIP1 and NDFIP2. Ubiquitinates RPB1 and promotes it to proteasomal degradation.	confident	O00308
NEDD4-like E3 ubiquitin-protein ligase WWP1	E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Ubiquitinates ERBB4 isoforms JM-A CYT-1 and JM-B CYT-1, KLF2, KLF5 and TP63 and promotes their proteasomal degradation. Ubiquitinates RNF11 without targeting it for degradation. Ubiquitinates and promotes degradation of TGFBR1; the ubiquitination is enhanced by SMAD7. Ubiquitinates SMAD6 and SMAD7.	confident	Q8BZZ3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0019915 [BP]	lipid storage	probable	GO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0070936 [BP]	protein K48-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0051224 [BP]	negative regulation of protein transport	probable	GO:0070201, GO:0032879, GO:0051051, GO:0051049, GO:0008150, GO:0065007, GO:0048519, GO:0051223, GO:0050789, GO:0032880
GO:0002684 [BP]	positive regulation of immune system process	probable	GO:0048518, GO:0065007, GO:0002682, GO:0050789, GO:0008150
GO:0002683 [BP]	negative regulation of immune system process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0002682, GO:0050789
GO:0043021 [MF]	ribonucleoprotein complex binding	probable	GO:0003674, GO:0005488
GO:0004842 [MF]	ubiquitin-protein ligase activity	probable	GO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0045746 [BP]	negative regulation of Notch signaling pathway	probable	GO:0009968, GO:0009966, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0008593, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0035519 [BP]	protein K29-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0031347 [BP]	regulation of defense response	probable	GO:0008150, GO:0065007, GO:0080134, GO:0048583, GO:0050789
GO:0070534 [BP]	protein K63-linked ubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0046718 [BP]	viral entry into host cell	probable	GO:0040011, GO:0044419, GO:0044703, GO:0000003, GO:0022414, GO:0009987, GO:0019048, GO:0052192, GO:0044764, GO:0022415, GO:0030260, GO:0051828, GO:0044409, GO:0008150, GO:0016032, GO:0052126, GO:0044403, GO:0051806, GO:0051701, GO:0051704
GO:0051239 [BP]	regulation of multicellular organismal process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0051246 [BP]	regulation of protein metabolic process	probable	GO:0080090, GO:0019222, GO:0060255, GO:0008150, GO:0065007, GO:0050789
GO:0008134 [MF]	transcription factor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0031623 [BP]	receptor internalization	probable	GO:0051234, GO:0006898, GO:0006897, GO:0016192, GO:0044260, GO:0006810, GO:0044237, GO:0043170, GO:0071704, GO:0044765, GO:0008150, GO:0008152, GO:0009987, GO:0043112, GO:0051179, GO:0044699
GO:0042787 [BP]	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0070647, GO:0032446, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0006511
GO:0032410 [BP]	negative regulation of transporter activity	probable	GO:0051051, GO:0051049, GO:0008150, GO:0032409, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0032879, GO:0050789
GO:0007219 [BP]	Notch signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0043433 [BP]	negative regulation of sequence-specific DNA binding transcription factor activity	probable	GO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0044092, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0065009, GO:0051252, GO:0010468
GO:0002376 [BP]	immune system process	probable	GO:0008150
GO:0042391 [BP]	regulation of membrane potential	probable	GO:0019725, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0005938 [CC]	cell cortex	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0045236 [MF]	CXCR chemokine receptor binding	probable	GO:0005126, GO:0042379, GO:0003674, GO:0005488, GO:0005515, GO:0001664, GO:0005102
GO:0043161 [BP]	proteasomal ubiquitin-dependent protein catabolic process	probable	GO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005112 [MF]	Notch binding	probable	GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0016348 [BP]	imaginal disc-derived leg joint morphogenesis	probable	GO:0048563, GO:0035108, GO:0048569, GO:0060173, GO:0035107, GO:0009887, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0035127, GO:0035282, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0007478, GO:0036022, GO:0035285, GO:0048513, GO:0048646, GO:0032502, GO:0048707, GO:0009886, GO:0007480, GO:0035218, GO:0044767, GO:0008150, GO:0003002, GO:0048731, GO:0035114, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0036011, GO:0007552, GO:0048736, GO:0048737
GO:0008587 [BP]	imaginal disc-derived wing margin morphogenesis	probable	GO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0031410 [CC]	cytoplasmic vesicle	probable	GO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:1901016 [BP]	regulation of potassium ion transmembrane transporter activity	probable	GO:0032412, GO:0008150, GO:0022898, GO:0050794, GO:0010959, GO:0043266, GO:0032409, GO:0065007, GO:1901379, GO:0034762, GO:0051049, GO:0034765, GO:0065009, GO:0032879, GO:0050789, GO:0043269

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OLM, chain A
Confidence level:very confident
Coverage over the Query: 639-989
View the alignment between query and template
View the model in PyMOL

Template: 3OLM, chain A
Confidence level:very confident
Coverage over the Query: 3-36,49-144
View the alignment between query and template
View the model in PyMOL

Template: 2KYK, chain A
Confidence level:very confident
Coverage over the Query: 509-542
View the alignment between query and template
View the model in PyMOL

Template: 1O6W, chain A
Confidence level:very confident
Coverage over the Query: 513-547,593-629
View the alignment between query and template
View the model in PyMOL

Template: 1O6W, chain A
Confidence level:very confident
Coverage over the Query: 376-436
View the alignment between query and template
View the model in PyMOL

Template: 2NQ3, chain A
Confidence level:very confident
Coverage over the Query: 147-252
View the alignment between query and template
View the model in PyMOL