Diaphorina citri psyllid: psy16329

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MLFLYFLVFRAAKFSNVYHLTCYFPTNFGSDNTCLYYLGFRGESSPLHRHGVTICNYETTPSLADHKVDNMNSFPVMAHNHGGHCCGEEDHSHDDTELGIQYSLYKHIDTENVECLNETVDGSGKTIFKPWEDRLNKEKFVESDVDSELLINIPFTSNIKLKGLRLIGGDSDSHPNRIKLFKNRPGMTFDDVNASPDQEFELNQDSDASIEYPIM
cEEEEEEEcEEEccccccEEEEEECccccccCEEEEEEEEEEECccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccECccccccEEEEEEccccEEEEEEEEEcccccccccEEEEEEcccccccccccccccEEEEECcccccEEEEccc
MLFLYFLVFRAAKFSNVYHLTCYFPTNFGSDNTCLYYLGFRGESSPLHRHGVTICNYETTPSLADHKVDNMNSFPV****************HDDTELGIQYSLYKHIDTENVECLNETVDGSGKTIFKPWEDRLNKEKFVESDVDSELLINIPFTSNIKLKGLRLIGG**DSHPNRIKLFKNRPGMTFDDVNASPDQEFELNQDSDA*IEYPIM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFLYFLVFRAAKFSNVYHLTCYFPTNFGSDNTCLYYLGFRGESSPLHRHGVTICNYETTPSLADHKVDNMNSFPVMAHNHGGHCCGEEDHSHDDTELGIQYSLYKHIDTENVECLNETVDGSGKTIFKPWEDRLNKEKFVESDVDSELLINIPFTSNIKLKGLRLIGGDSDSHPNRIKLFKNRPGMTFDDVNASPDQEFELNQDSDASIEYPIM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PITH domain-containing protein GA19395 confidentQ29L80
PITH domain-containing protein ZK353.9 confidentQ95ZI6
PITH domain-containing protein 1 confidentQ6NYX8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XOY, chain A
Confidence level:very confident
Coverage over the Query: 101-215
View the alignment between query and template
View the model in PyMOL
Template: 1WWY, chain A
Confidence level:very confident
Coverage over the Query: 7-51
View the alignment between query and template
View the model in PyMOL