Diaphorina citri psyllid: psy16330


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MFLLQDYFSSVLQLLQLVECAHLRRGGQGGGLLKPNPYIELYVDYKNPKTTRVVKNTYQPKWNEEFTVLVSPYSIILFRLLDHRTFRRDCTIGEKRLNTST
ccEEcccccccEEEEEEEEEEEEccccccccccccccEEEEEEccccCEEEEEEccccccccccEEEEEEccccEEEEEEEEccccccccccCEEEEEccc
*FLLQDYFSSVLQLLQLVECAHLRRGGQGGGLLKPNPYIELYVDYKNPKTTRVVKNTYQPKWNEEFTVLVSPYSIILFRLLDHRTFRRDCTIGEKRLNTS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLLQDYFSSVLQLLQLVECAHLRRGGQGGGLLKPNPYIELYVDYKNPKTTRVVKNTYQPKWNEEFTVLVSPYSIILFRLLDHRTFRRDCTIGEKRLNTST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase Su(dx) E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Down-regulates Notch/N signaling pathway, probably by promoting Notch ubiquitination, endocytosis and degradation. Involved in wing growth and leg joint formation.confidentQ9Y0H4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0019915 [BP]lipid storageprobableGO:0008150, GO:0033036, GO:0010876, GO:0051179
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0003674 [MF]molecular_functionprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R83, chain A
Confidence level:very confident
Coverage over the Query: 2-100
View the alignment between query and template
View the model in PyMOL