Diaphorina citri psyllid: psy16342

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---

MSSSKVPIGYLTRVEKFSACHRLHSPHLTDEENKITYGKCNNFHGHGHNYTVEVTLKGPISKERGMVLNINDLKVYMVDAIMVPMDHKNLDKDVPYFADVVSTSENVAIFIWNNLKKIMKEPELLYEVKLYETDKNIVLYRGE

cccccccEEEEEEEEEEEcccccccccccccccccccccccccccccEEEEEEEEEEEcccccccCEEEHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEEECccccEEEECcc

******PIGYLTRVEKFSACHRLHSPHLTDEENKITYGKCNNFHGHGHNYTVEVTLKGPISKERGMVLNINDLKVYMVDAIMVPMDHKNLDKDVPYFADVVSTSENVAIFIWNNLKKIMKEPELLYEVKLYETDKNIVLYRGE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSSKVPIGYLTRVEKFSACHRLHSPHLTDEENKITYGKCNNFHGHGHNYTVEVTLKGPISKERGMVLNINDLKVYMVDAIMVPMDHKNLDKDVPYFADVVSTSENVAIFIWNNLKKIMKEPELLYEVKLYETDKNIVLYRGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
6-pyruvoyl tetrahydrobiopterin synthase	Involved in the biosynthesis of tetrahydrobiopterin, an essential cofactor of aromatic amino acid hydroxylases. Catalyzes the transformation of 7,8-dihydroneopterin triphosphate into 6-pyruvoyl tetrahydropterin.	very confident	P27213
Putative 6-pyruvoyl tetrahydrobiopterin synthase	Involved in the biosynthesis of tetrahydrobiopterin, an essential cofactor of aromatic amino acid hydroxylases. Catalyzes the transformation of 7,8-dihydroneopterin triphosphate into 6-pyruvoyl tetrahydropterin.	very confident	O02058
6-pyruvoyl tetrahydrobiopterin synthase	Involved in the biosynthesis of tetrahydrobiopterin, an essential cofactor of aromatic amino acid hydroxylases. Catalyzes the transformation of 7,8-dihydroneopterin triphosphate into 6-pyruvoyl tetrahydropterin.	very confident	Q5REZ5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0046656 [BP]	folic acid biosynthetic process	confident	GO:0044238, GO:0042398, GO:0019752, GO:0042364, GO:0044249, GO:0034641, GO:0006807, GO:0009108, GO:0044281, GO:0044711, GO:0044283, GO:0046655, GO:1901360, GO:1901576, GO:0044710, GO:0009396, GO:0071704, GO:1901362, GO:0043650, GO:0006520, GO:0051188, GO:0042558, GO:0042559, GO:0006732, GO:0006082, GO:1901605, GO:1901607, GO:0018130, GO:0006767, GO:0006766, GO:0006760, GO:0008652, GO:0009987, GO:0006725, GO:0009058, GO:0009110, GO:0008150, GO:0008152, GO:0043436, GO:1901564, GO:0046483, GO:0043648, GO:0044271, GO:0006575, GO:1901566, GO:0046394, GO:0016053, GO:0044237, GO:0051186, GO:0019438
GO:0005739 [CC]	mitochondrion	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]	identical protein binding	confident	GO:0003674, GO:0005488, GO:0005515
GO:0006728 [BP]	pteridine biosynthetic process	confident	GO:0044249, GO:0034641, GO:0006807, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0042440, GO:0042558, GO:0042559, GO:0071704, GO:0018130, GO:0019889, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:0044271, GO:0046148, GO:0046483, GO:1901564, GO:1901566, GO:0044237, GO:0019438
GO:0006729 [BP]	tetrahydrobiopterin biosynthetic process	confident	GO:0006732, GO:0044249, GO:0034641, GO:0006807, GO:0009108, GO:1901362, GO:1901360, GO:1901576, GO:0051186, GO:0051188, GO:0042558, GO:0042559, GO:0071704, GO:0018130, GO:0009987, GO:0006725, GO:0009058, GO:0046146, GO:0008150, GO:0008152, GO:1901564, GO:0046483, GO:0044271, GO:1901566, GO:0044237, GO:0019438
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007417 [BP]	central nervous system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0046209 [BP]	nitric oxide metabolic process	probable	GO:0006807, GO:0008150, GO:0008152
GO:0003874 [MF]	6-pyruvoyltetrahydropterin synthase activity	probable	GO:0016835, GO:0016829, GO:0016838, GO:0003674, GO:0003824
GO:0050999 [BP]	regulation of nitric-oxide synthase activity	probable	GO:0051341, GO:0019222, GO:0032768, GO:0050790, GO:0065007, GO:0008150, GO:0065009, GO:0050789
GO:0044351 [BP]	macropinocytosis	probable	GO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0070497 [MF]	6-carboxy-5,6,7,8-tetrahydropterin synthase activity	probable	GO:0016835, GO:0016836, GO:0003674, GO:0016829, GO:0003824

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
4.-.-.-	Lyases.	probable
4.2.-.-	Carbon-oxygen lyases.	probable
4.2.3.-	Acting on phosphates.	probable
4.2.3.12	Transferred entry: 4.2.3.119 and 4.2.3.120.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2G64, chain A
Confidence level:very confident
Coverage over the Query: 6-143
View the alignment between query and template
View the model in PyMOL