Diaphorina citri psyllid: psy16353


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MVDIKPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR
cccccccccccccccHHHHHHHHHHccccccccEEEEEEcccccHHHHHccccccccccCEEEEEEccccccEEEccEEEEEEccccEEEccccccccCEEEEEEEcHHcHHHcccccccccccEEEEEEEc
***IKPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESS*********RVSEGRVYYMVTR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDIKPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative ATP-dependent RNA helicase TDRD9 Probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with PIWIL4 and the piP-bodies suggests a participation in the secondary piRNAs metabolic process.confidentQ8NDG6
Probable ATP-dependent RNA helicase spindle-E Probable ATP-binding RNA helicase which plays a central role during spermatogenesis and oogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi and govern the methylation and subsequent repression of transposons. Involved in the repression of LTR retrotransposon copia. Also involved in telomere regulation by repressing specialized telomeric retroelements HeT-A, TAHRE, and TART; Drosophila telomeres being maintained by transposition of specialized telomeric retroelements. Involved in telomeric trans-silencing, a repression mechanism by which a transposon or a transgene inserted in subtelomeric heterochromatin has the capacity to repress in trans in the female germline, a homologous transposon, or transgene located in euchromatin. Involved in the repression of testis-expressed Stellate genes by the homologous Su(Ste) repeats. Required for anteroposterior and dorsoventral axis formation during oogenesis.confidentQ9VF26
Putative ATP-dependent RNA helicase TDRD9 Probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with the piP-bodies suggests a participation in the secondary piRNAs metabolic process.confidentB8A4F4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008186 [MF]RNA-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0071547 [CC]piP-bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0043226, GO:0044424, GO:0043186, GO:0005622, GO:0032991, GO:0045495
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0003676 [MF]nucleic acid bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0005488
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0003724 [MF]RNA helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0004386
GO:0090304 [BP]nucleic acid metabolic processprobableGO:0006139, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XAU, chain A
Confidence level:very confident
Coverage over the Query: 14-132
View the alignment between query and template
View the model in PyMOL