Psyllid ID: psy16353

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MVDIKPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR
cccccccccccccccHHHHHHHHHHccccccccEEEEEEcccccHHHHHccccccccccEEEEEEEccccccEEEccEEEEEEccccEEEccccccccEEEEEEEEcHHcHHHcccccccccccEEEEEEEc
ccccccccEEEEEccHHHHHHHHHHHccccccEEEEEEEHccccHHHHHHHcccccccccEEEEEEEcEEEEEEEccEEEEEccccEEEccccccccccEEEEcEccHHHHHHccccccccccccEEEEEcc
mvdikpgtfsphatfspniSLLLCSSLNKPEVQWKIVVLHSsipkeqqdlvftrfppgvrkIVLStniaessitvpdvKYVVDFCLTKVLTvaegsnyssLQLEWASESSCQQragrvgrvseGRVYYMVTR
mvdikpgtfsphatfspNISLLLCSSLNKPEVQWKIVVLHSsipkeqqdlVFTRFPPGVRKIVLstniaessitvpdvkYVVDFCLTKVLTVAEGSNYSSLQLewasesscqqragrvgrvsegrvyymvtr
MVDIKPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR
*************TFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWA*****************GRVYY****
***IKPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR
MVDIKPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQ*****************RVSEGRVYYMVTR
****KPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESS*************GRVYY*VTR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDIKPGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
B4PRJ9 1436 Probable ATP-dependent RN N/A N/A 0.931 0.085 0.543 9e-30
B4GEU5 1434 Probable ATP-dependent RN N/A N/A 0.939 0.086 0.504 1e-29
Q7QCW2 1463 Probable ATP-dependent RN yes N/A 0.818 0.073 0.541 3e-29
B4K5R2 1431 Probable ATP-dependent RN N/A N/A 0.780 0.071 0.592 1e-28
Q9VF26 1434 Probable ATP-dependent RN yes N/A 0.840 0.077 0.558 1e-28
B3P3W1 1432 Probable ATP-dependent RN N/A N/A 0.878 0.081 0.546 2e-28
Q3MHU3 1384 Putative ATP-dependent RN yes N/A 0.818 0.078 0.549 2e-28
Q14BI7 1383 Putative ATP-dependent RN yes N/A 0.818 0.078 0.549 2e-28
Q296Q5 1433 Probable ATP-dependent RN yes N/A 0.939 0.086 0.488 3e-28
Q8NDG6 1382 Putative ATP-dependent RN yes N/A 0.818 0.078 0.558 4e-28
>sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 Back     alignment and function desciption
 Score =  128 bits (322), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 4/127 (3%)

Query: 6   PGTFSPHATFSPNISLLLCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLS 65
           PG +    T + NI+L+L +  N   V+  IV   S +  E Q  VF   PPG RKI+L+
Sbjct: 371 PGIYEID-TMAENITLMLENDRN---VKVFIVRCFSLMTPENQRDVFHPPPPGFRKIILT 426

Query: 66  TNIAESSITVPDVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGR 125
           TNIAESSITVPDV YV+DFCLTKVL     +N+SSL+L WAS+++C+QRAGRVGR+  GR
Sbjct: 427 TNIAESSITVPDVSYVIDFCLTKVLVTDTATNFSSLRLTWASKANCRQRAGRVGRLRSGR 486

Query: 126 VYYMVTR 132
           VY MV +
Sbjct: 487 VYRMVNK 493
Probable ATP-binding RNA helicase which plays a central role during spermatogenesis and oogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi and govern the methylation and subsequent repression of transposons. Involved in the repression of LTR retrotransposon copia. Also involved in telomere regulation by repressing specialized telomeric retroelements HeT-A, TAHRE, and TART; Drosophila telomeres being maintained by transposition of specialized telomeric retroelements. Involved in telomeric trans-silencing, a repression mechanism by which a transposon or a transgene inserted in subtelomeric heterochromatin has the capacity to repress in trans in the female germline, a homologous transposon, or transgene located in euchromatin. Involved in the repression of testis-expressed Stellate genes by the homologous Su(Ste) repeats. Required for anteroposterior and dorsoventral axis formation during oogenesis.
Drosophila yakuba (taxid: 7245)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 Back     alignment and function description
>sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 Back     alignment and function description
>sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 Back     alignment and function description
>sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 Back     alignment and function description
>sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 Back     alignment and function description
>sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 Back     alignment and function description
>sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 Back     alignment and function description
>sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 Back     alignment and function description
>sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
307192986 1196 Putative ATP-dependent RNA helicase TDRD 0.863 0.095 0.612 2e-32
332023535 1208 Putative ATP-dependent RNA helicase TDRD 0.757 0.082 0.66 3e-32
357621110 1377 putative ATP-dependent RNA helicase [Dan 0.772 0.074 0.598 9e-31
443725665 686 hypothetical protein CAPTEDRAFT_117270, 0.909 0.174 0.566 1e-30
322801536 1175 hypothetical protein SINV_15467 [Solenop 0.772 0.086 0.607 2e-30
307167438 1208 Putative ATP-dependent RNA helicase TDRD 0.878 0.096 0.559 3e-30
340713680 1427 PREDICTED: probable ATP-dependent RNA he 0.916 0.084 0.532 5e-30
383859492 1430 PREDICTED: probable ATP-dependent RNA he 0.795 0.073 0.584 2e-29
350417406 1452 PREDICTED: probable ATP-dependent RNA he 0.916 0.083 0.532 2e-29
380026041 1419 PREDICTED: LOW QUALITY PROTEIN: probable 0.772 0.071 0.568 6e-29
>gi|307192986|gb|EFN75974.1| Putative ATP-dependent RNA helicase TDRD9 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 89/116 (76%), Gaps = 2/116 (1%)

Query: 19  ISLLLCS-SLNK-PEVQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVP 76
           I  L C+ SL+K  +++W I++LHS I  E Q+ +F +   G R+I+LSTNIAESS+TVP
Sbjct: 369 IEELRCALSLDKYSDMKWDIIILHSLISTEDQEKIFKKPFKGYRRIILSTNIAESSVTVP 428

Query: 77  DVKYVVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR 132
           DVKYV+DFCLTKVL    GSNY SLQL WAS+S+CQQRAGR GR+ +GRVY MV R
Sbjct: 429 DVKYVIDFCLTKVLVTNPGSNYQSLQLCWASKSNCQQRAGRAGRIMDGRVYRMVPR 484

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332023535|gb|EGI63771.1| Putative ATP-dependent RNA helicase TDRD9 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357621110|gb|EHJ73063.1| putative ATP-dependent RNA helicase [Danaus plexippus] Back     alignment and taxonomy information
>gi|443725665|gb|ELU13161.1| hypothetical protein CAPTEDRAFT_117270, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|322801536|gb|EFZ22197.1| hypothetical protein SINV_15467 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307167438|gb|EFN61014.1| Putative ATP-dependent RNA helicase TDRD9 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340713680|ref|XP_003395367.1| PREDICTED: probable ATP-dependent RNA helicase spindle-E-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383859492|ref|XP_003705228.1| PREDICTED: probable ATP-dependent RNA helicase spindle-E-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350417406|ref|XP_003491407.1| PREDICTED: probable ATP-dependent RNA helicase spindle-E-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380026041|ref|XP_003696770.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase spindle-E-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
UNIPROTKB|E2RNZ8 1115 TDRD9 "Uncharacterized protein 0.742 0.087 0.602 7.4e-26
UNIPROTKB|J9P8U1 1120 TDRD9 "Uncharacterized protein 0.742 0.087 0.602 7.5e-26
UNIPROTKB|E2RNZ9 1127 TDRD9 "Uncharacterized protein 0.742 0.086 0.602 7.5e-26
MGI|MGI:1921941 1383 Tdrd9 "tudor domain containing 0.818 0.078 0.549 8e-26
UNIPROTKB|H0YJJ2 918 TDRD9 "Putative ATP-dependent 0.803 0.115 0.568 8.7e-26
RGD|1306942 1384 Tdrd9 "tudor domain containing 0.818 0.078 0.549 1e-25
UNIPROTKB|F1MNA1 1392 TDRD9 "Uncharacterized protein 0.727 0.068 0.604 1.3e-25
FB|FBgn0003483 1434 spn-E "spindle E" [Drosophila 0.840 0.077 0.558 1.4e-25
UNIPROTKB|Q8NDG6 1382 TDRD9 "Putative ATP-dependent 0.803 0.076 0.568 1.7e-25
UNIPROTKB|C3XYZ4 1475 BRAFLDRAFT_65715 "Putative unc 0.742 0.066 0.595 1.8e-25
UNIPROTKB|E2RNZ8 TDRD9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 305 (112.4 bits), Expect = 7.4e-26, P = 7.4e-26
 Identities = 59/98 (60%), Positives = 74/98 (75%)

Query:    35 KIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTVAE 94
             ++  LHSS+  E+Q+ VF    PG RKI+LSTNIAESS+TVPDVKYV+DFCLT+ L   E
Sbjct:   147 QVYPLHSSVTLEEQNNVFLSPVPGYRKIILSTNIAESSVTVPDVKYVIDFCLTRTLVCDE 206

Query:    95 GSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR 132
              +NY SL+L WAS++SC QR GR GRVS+G  Y +V R
Sbjct:   207 DTNYQSLRLSWASKTSCNQRKGRAGRVSKGYCYRLVHR 244
GO:0005524 "ATP binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|J9P8U1 TDRD9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNZ9 TDRD9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1921941 Tdrd9 "tudor domain containing 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H0YJJ2 TDRD9 "Putative ATP-dependent RNA helicase TDRD9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306942 Tdrd9 "tudor domain containing 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNA1 TDRD9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0003483 spn-E "spindle E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NDG6 TDRD9 "Putative ATP-dependent RNA helicase TDRD9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C3XYZ4 BRAFLDRAFT_65715 "Putative uncharacterized protein" [Branchiostoma floridae (taxid:7739)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VF26SPNE_DROME3, ., 6, ., 4, ., 1, 30.55850.84090.0774yesN/A
B8A4F4TDRD9_DANRE3, ., 6, ., 4, ., 1, 30.58510.71210.0700yesN/A
Q7QCW2SPNE_ANOGA3, ., 6, ., 4, ., 1, 30.54120.81810.0738yesN/A
Q3MHU3TDRD9_RAT3, ., 6, ., 4, ., 1, 30.54950.81810.0780yesN/A
Q8NDG6TDRD9_HUMAN3, ., 6, ., 4, ., 1, 30.55850.81810.0781yesN/A
Q14BI7TDRD9_MOUSE3, ., 6, ., 4, ., 1, 30.54950.81810.0780yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 2e-27
smart0049082 smart00490, HELICc, helicase superfamily c-termina 5e-19
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-17
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 6e-17
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 7e-16
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-15
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 2e-13
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 7e-09
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase re 1e-05
PHA02653 675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 2e-05
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 3e-05
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 9e-05
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 0.002
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  105 bits (264), Expect = 2e-27
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 2/107 (1%)

Query: 23  LCSSLNKPEVQWKIVV--LHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKY 80
               L K E+   + +  L+ ++  E+Q  VF   P G RK+VL+TNIAE+S+T+P ++Y
Sbjct: 275 TAEWLEKAELGDDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTIPGIRY 334

Query: 81  VVDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVY 127
           V+D  L K       +  + L+ E  S++S  QRAGR GR   G  Y
Sbjct: 335 VIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRTGPGICY 381

Length = 845
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.97
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.96
KOG0331|consensus519 99.96
KOG0330|consensus476 99.95
KOG0922|consensus 674 99.95
KOG0923|consensus 902 99.95
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.94
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.94
KOG0328|consensus400 99.93
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.93
KOG0924|consensus 1042 99.93
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.93
PHA02653 675 RNA helicase NPH-II; Provisional 99.92
KOG0333|consensus673 99.92
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.92
PTZ00110545 helicase; Provisional 99.92
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.91
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.9
KOG0920|consensus 924 99.9
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.9
KOG0340|consensus442 99.9
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.9
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.9
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.9
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.9
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.89
KOG0342|consensus 543 99.89
KOG0332|consensus477 99.89
KOG0326|consensus459 99.89
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.89
PTZ00424401 helicase 45; Provisional 99.89
KOG0925|consensus 699 99.89
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.89
KOG0926|consensus 1172 99.88
KOG0336|consensus629 99.88
KOG0335|consensus482 99.87
KOG0345|consensus 567 99.87
KOG0341|consensus610 99.86
KOG0343|consensus 758 99.86
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.86
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.86
KOG0338|consensus 691 99.86
KOG0347|consensus 731 99.85
KOG0344|consensus593 99.83
KOG0348|consensus 708 99.83
KOG0349|consensus 725 99.83
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.82
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.82
KOG0350|consensus620 99.81
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.8
PRK13767 876 ATP-dependent helicase; Provisional 99.8
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.8
PRK10689 1147 transcription-repair coupling factor; Provisional 99.8
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.79
KOG0327|consensus397 99.79
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.78
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.78
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.77
KOG0339|consensus 731 99.75
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.75
PRK04914 956 ATP-dependent helicase HepA; Validated 99.75
KOG0354|consensus 746 99.75
PRK05298652 excinuclease ABC subunit B; Provisional 99.75
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.74
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.74
PRK13766 773 Hef nuclease; Provisional 99.74
KOG4284|consensus 980 99.73
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.71
KOG0346|consensus 569 99.69
PRK02362 737 ski2-like helicase; Provisional 99.68
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.68
PRK00254 720 ski2-like helicase; Provisional 99.68
KOG0334|consensus 997 99.67
PRK01172 674 ski2-like helicase; Provisional 99.67
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.67
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.66
smart0049082 HELICc helicase superfamily c-terminal domain. 99.65
PHA02558501 uvsW UvsW helicase; Provisional 99.65
KOG0351|consensus 941 99.63
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.61
KOG0337|consensus 529 99.6
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.6
KOG0352|consensus 641 99.59
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.59
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.54
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.49
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.49
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.41
PRK09694 878 helicase Cas3; Provisional 99.4
COG1202 830 Superfamily II helicase, archaea-specific [General 99.4
PRK09401 1176 reverse gyrase; Reviewed 99.38
PRK14701 1638 reverse gyrase; Provisional 99.33
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.32
KOG0353|consensus 695 99.29
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.27
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.26
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.24
COG1205 851 Distinct helicase family with a unique C-terminal 99.21
PRK05580 679 primosome assembly protein PriA; Validated 99.16
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.14
KOG0329|consensus387 99.1
COG1204 766 Superfamily II helicase [General function predicti 99.09
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.07
KOG0921|consensus 1282 99.07
KOG0950|consensus 1008 99.02
KOG0953|consensus 700 99.0
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.99
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 98.97
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.92
KOG4150|consensus 1034 98.91
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.88
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.76
KOG0951|consensus 1674 98.59
KOG0948|consensus 1041 98.5
KOG0947|consensus 1248 98.41
KOG0952|consensus 1230 98.09
KOG0392|consensus1549 97.99
KOG0385|consensus 971 97.99
KOG0949|consensus 1330 97.97
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 97.85
KOG1123|consensus 776 97.82
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.82
KOG0390|consensus776 97.75
KOG0384|consensus 1373 97.64
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.55
KOG0389|consensus941 97.55
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 97.52
KOG0387|consensus 923 97.49
COG4096 875 HsdR Type I site-specific restriction-modification 97.48
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.48
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.48
KOG0391|consensus 1958 97.35
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.23
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.22
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.17
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.91
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 96.77
COG4889 1518 Predicted helicase [General function prediction on 96.74
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 96.49
KOG0388|consensus1185 96.06
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 95.72
KOG1000|consensus689 95.53
KOG1015|consensus 1567 95.4
KOG1002|consensus791 95.31
CHL00122 870 secA preprotein translocase subunit SecA; Validate 95.28
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.18
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.0
PRK05580 679 primosome assembly protein PriA; Validated 94.46
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 94.4
smart00491142 HELICc2 helicase superfamily c-terminal domain. 94.2
smart00492141 HELICc3 helicase superfamily c-terminal domain. 94.04
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 93.89
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 93.66
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 93.61
TIGR00595 505 priA primosomal protein N'. All proteins in this f 93.45
PF13871 278 Helicase_C_4: Helicase_C-like 93.43
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 93.25
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 92.56
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 92.45
KOG4439|consensus901 92.4
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 91.97
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 91.94
PRK10689 1147 transcription-repair coupling factor; Provisional 91.36
PRK14873 665 primosome assembly protein PriA; Provisional 90.49
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 89.11
COG1198 730 PriA Primosomal protein N' (replication factor Y) 88.93
KOG0347|consensus 731 88.7
PRK14701 1638 reverse gyrase; Provisional 88.58
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 86.17
KOG0701|consensus 1606 85.95
KOG0339|consensus 731 85.11
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 84.46
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 84.43
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 83.65
PRK14873 665 primosome assembly protein PriA; Provisional 82.86
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 82.22
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 82.21
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 81.96
KOG1016|consensus 1387 81.84
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 81.66
KOG0331|consensus 519 81.58
KOG0951|consensus 1674 80.98
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 80.2
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 80.18
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information 
Probab=99.97  E-value=1e-30  Score=217.28  Aligned_cols=117  Identities=29%  Similarity=0.395  Sum_probs=111.5

Q ss_pred             CCCeEEEEeecCCCCC-----------CCceEEEecCCCCHHHHHHHhhcCCCCceEEEEeccccccccccCCccEEEec
Q psy16353         16 SPNISLLLCSSLNKPE-----------VQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDF   84 (132)
Q Consensus        16 ~~~~~ivF~~t~~~~~-----------~~~~~~~lh~~l~~~~r~~~~~~f~~g~~~vlvaT~~~~~Gldi~~v~~VI~~   84 (132)
                      .++++|||+++.++++           .++.+.++||+|++++|.++++.|++|+++||||||+||+|||||+|++|||+
T Consensus       208 ~~g~iLVFlpg~~eI~~l~~~L~~~~~~~~~v~pLHg~L~~~eq~~~~~~~~~G~rkVlVATnIAErgItIp~V~~VID~  287 (819)
T TIGR01970       208 ETGSILVFLPGQAEIRRVQEQLAERLDSDVLICPLYGELSLAAQDRAIKPDPQGRRKVVLATNIAETSLTIEGIRVVIDS  287 (819)
T ss_pred             cCCcEEEEECCHHHHHHHHHHHHhhcCCCcEEEEecCCCCHHHHHHHHhhcccCCeEEEEecchHhhcccccCceEEEEc
Confidence            3689999999988772           47899999999999999999999999999999999999999999999999999


Q ss_pred             CCCceeeecCCCCcccccccccCHhhHHHhhcccCCCCCceEEEEEeC
Q psy16353         85 CLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVTR  132 (132)
Q Consensus        85 ~~p~~~~~~~~~~~~~~~~~~~s~~~~~qR~GR~gR~~~g~~~~l~s~  132 (132)
                      |+|+...|||..+.+.+...|||+++|.||+||+||.++|.||+|||+
T Consensus       288 Gl~r~~~yd~~~g~~~L~~~~iSkasa~QR~GRAGR~~~G~cyrL~t~  335 (819)
T TIGR01970       288 GLARVARFDPKTGITRLETVRISQASATQRAGRAGRLEPGVCYRLWSE  335 (819)
T ss_pred             CcccccccccccCCceeeEEEECHHHHHhhhhhcCCCCCCEEEEeCCH
Confidence            999999999999999999999999999999999999999999999984

This model represents HrpB, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti has been designated HelO. HrpB is typically about 800 residues in length, while its paralog HrpA (TIGR01967), also uncharacterized, is about 1300 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing.
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 3e-11
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 3e-11
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 7e-04
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 7e-04
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 7e-04
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 9e-04
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 9e-04
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 55/99 (55%), Gaps = 7/99 (7%)
Query: 39  LHSSIPKEQQDLVFTRFP------PGVRKIVLSTNIAESSITVPDVKYVVDFCLTKVLTV 92
           L+ S+P  QQ  +F   P      PG RK+V+STNIAE+S+T+  + YVVD   +K    
Sbjct: 344 LYGSLPPHQQQRIFEPAPESHNGRPG-RKVVISTNIAETSLTIDGIVYVVDPGFSKQKVY 402
Query: 93  AEGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMVT 131
                  SL +   S++S QQRAGR GR   G+ + + T
Sbjct: 403 NPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYT 441
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 8e-26
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 9e-23
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 3e-22
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 2e-21
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 7e-21
1yks_A 440 Genome polyprotein [contains: flavivirin protease 1e-20
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 1e-20
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-20
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-06
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 3e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  100 bits (250), Expect = 8e-26
 Identities = 38/116 (32%), Positives = 56/116 (48%), Gaps = 19/116 (16%)

Query: 23  LCSSLNKPEVQWKIVVLHSSIPKEQQDLVFTRFPPGV-----RKIVLSTNIAESSITVPD 77
           L        +   +  L+ S+P  QQ  +F   P        RK+V+STNIAE+S+T+  
Sbjct: 330 LVREEGCGPL--SVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDG 387

Query: 78  VKYVVDFCLTKVLTVAEGSNYS------SLQLEWASESSCQQRAGRVGRVSEGRVY 127
           + YVVD   +K         Y+      SL +   S++S QQRAGR GR   G+ +
Sbjct: 388 IVYVVDPGFSKQ------KVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCF 437
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.94
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.94
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.93
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.93
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.93
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.92
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.92
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.91
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.91
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.85
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.9
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.88
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.88
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.88
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.88
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.88
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.88
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.88
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.87
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.87
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.87
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.87
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.86
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.86
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.85
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.84
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.84
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.84
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.84
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.84
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.83
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.83
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.83
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.83
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.82
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.82
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.82
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.82
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.82
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.82
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.81
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.81
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.81
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.8
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.79
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.79
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.79
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.79
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.78
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.77
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.76
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.74
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.73
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.72
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.72
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.71
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.71
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.7
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.68
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.68
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.67
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.65
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.63
3h1t_A590 Type I site-specific restriction-modification syst 99.61
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.59
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.57
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.54
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.51
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.46
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.06
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.88
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 95.48
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 94.81
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 94.24
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 93.58
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 93.01
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 85.81
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 85.78
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
Probab=99.94  E-value=9.3e-28  Score=171.44  Aligned_cols=104  Identities=23%  Similarity=0.447  Sum_probs=93.8

Q ss_pred             ccccCCCCeEEEEeecCCCCC--------CCceEEEecCCCCHHHHHHHhhcCCCCceEEEEeccccccccccCCccEEE
Q psy16353         11 PHATFSPNISLLLCSSLNKPE--------VQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVV   82 (132)
Q Consensus        11 ~~~~~~~~~~ivF~~t~~~~~--------~~~~~~~lh~~l~~~~r~~~~~~f~~g~~~vlvaT~~~~~Gldi~~v~~VI   82 (132)
                      +.....++++||||++++.++        .++.+.++||+|++++|.+++++|+.|+.+|||||+++++|+|+|++++||
T Consensus        25 ll~~~~~~~~lVF~~~~~~~~~l~~~L~~~~~~~~~lhg~~~~~~r~~~~~~f~~g~~~vlvaT~~~~~Gidi~~v~~Vi  104 (212)
T 3eaq_A           25 LLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVV  104 (212)
T ss_dssp             HHHHHCCSCEEEECSSHHHHHHHHHHHHHHTCCEEEECSSSCHHHHHHHHHHHHSSSCCEEEECTTTTCSSSCCCBSEEE
T ss_pred             HHHhCCCCeEEEEeCCHHHHHHHHHHHHHcCCCEEEEECCCCHHHHHHHHHHHHCCCCeEEEecChhhcCCCCccCcEEE
Confidence            334456889999999998873        688999999999999999999999999999999999999999999999999


Q ss_pred             ecCCCceeeecCCCCcccccccccCHhhHHHhhcccCCC-CCceEEEEEeC
Q psy16353         83 DFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRV-SEGRVYYMVTR  132 (132)
Q Consensus        83 ~~~~p~~~~~~~~~~~~~~~~~~~s~~~~~qR~GR~gR~-~~g~~~~l~s~  132 (132)
                      ++|+|.                  |.++|+||+||+||. ++|.|+.|+++
T Consensus       105 ~~~~p~------------------~~~~~~qr~GR~gR~g~~g~~~~l~~~  137 (212)
T 3eaq_A          105 HYRLPD------------------RAEAYQHRSGRTGRAGRGGRVVLLYGP  137 (212)
T ss_dssp             ESSCCS------------------SHHHHHHHHTTBCCCC--BEEEEEECG
T ss_pred             ECCCCc------------------CHHHHHHHhcccCCCCCCCeEEEEEch
Confidence            999998                  479999999999999 69999999873
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 1e-16
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-13
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 7e-08
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 4e-05
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score = 71.9 bits (176), Expect = 1e-16
 Identities = 24/97 (24%), Positives = 37/97 (38%), Gaps = 6/97 (6%)

Query: 35  KIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYVVDFCLT-KVLTVA 93
            +VVL+    + +               +L+T+IAE    +  V+ V+D     K + V 
Sbjct: 62  SVVVLNRKTFEREY----PTIKQKKPDFILATDIAEMGANL-CVERVLDCRTAFKPVLVD 116

Query: 94  EGSNYSSLQLEWASESSCQQRAGRVGRVSEGRVYYMV 130
           EG   +       S SS  QR GR+GR          
Sbjct: 117 EGRKVAIKGPLRISASSAAQRRGRIGRNPNRDGDSYY 153
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.95
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.95
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.95
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.94
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.94
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.94
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.9
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.87
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.86
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.85
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.79
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.78
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.78
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.75
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.71
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.7
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.23
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.18
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.77
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.24
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.94
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.82
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 84.9
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 82.19
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.95  E-value=3.2e-29  Score=171.17  Aligned_cols=105  Identities=24%  Similarity=0.466  Sum_probs=93.6

Q ss_pred             cccccCCCCeEEEEeecCCCCC--------CCceEEEecCCCCHHHHHHHhhcCCCCceEEEEeccccccccccCCccEE
Q psy16353         10 SPHATFSPNISLLLCSSLNKPE--------VQWKIVVLHSSIPKEQQDLVFTRFPPGVRKIVLSTNIAESSITVPDVKYV   81 (132)
Q Consensus        10 ~~~~~~~~~~~ivF~~t~~~~~--------~~~~~~~lh~~l~~~~r~~~~~~f~~g~~~vlvaT~~~~~Gldi~~v~~V   81 (132)
                      .+.+.....++||||+|+..++        .++.+..+||+|++++|.++++.|+.|+.++|||||++++|+|+|+|++|
T Consensus        20 ~ll~~~~~~k~iIF~~s~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~l~~f~~~~~~iLv~Tdv~~rGiDi~~v~~V   99 (162)
T d1fuka_          20 DLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV   99 (162)
T ss_dssp             HHHHHTTCSCEEEEESSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEEEGGGTTTCCCCSCSEE
T ss_pred             HHHHhCCCCcEEEEEEEEchHHHHHHHHhhcCceEEEeccCCchhhHHHHHHHHhhcccceeeccccccccccCCCceEE
Confidence            4455667889999999999884        78999999999999999999999999999999999999999999999999


Q ss_pred             EecCCCceeeecCCCCcccccccccCHhhHHHhhcccCCC-CCceEEEEEeC
Q psy16353         82 VDFCLTKVLTVAEGSNYSSLQLEWASESSCQQRAGRVGRV-SEGRVYYMVTR  132 (132)
Q Consensus        82 I~~~~p~~~~~~~~~~~~~~~~~~~s~~~~~qR~GR~gR~-~~g~~~~l~s~  132 (132)
                      |+||+|.+                  .+.|+||+||+||. +.|.|+.++++
T Consensus       100 I~~d~P~~------------------~~~yihR~GR~gR~g~~g~~i~~~~~  133 (162)
T d1fuka_         100 INYDLPAN------------------KENYIHRIGRGGRFGRKGVAINFVTN  133 (162)
T ss_dssp             EESSCCSS------------------GGGGGGSSCSCC-----CEEEEEEET
T ss_pred             EEeccchh------------------HHHHHhhccccccCCCccEEEEEcCH
Confidence            99999984                  69999999999999 88999999874
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure