Diaphorina citri psyllid: psy16364


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MSKILKTHPKSVQSHRDLIMQCLDDKDESIRLRALDLLYGMVSKKTLMEIVKKLMVHMDKAEGTMYRDELLSKVIDICSQNNYQYITNFEWYMTVLVELTRMEGTRHGALVAAQMMDVAIRVSAVRAFAVAQMSSLLASPSPPLSQPSSRMAEMMFDEYSDRSSKIFNIKFSSRMPNHMKYLGLLAMSKILKTHPKSVQSHRDLIMQCLDDKDESIRLRALDLLYGMVSKKTLMEIVKKLMVHMDKAEGTMYRDELLSKVIDICSQNNYQYITNFE
ccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccc
MSKILKTHPKSVQSHRDLIMQCLDDKDESIRLRALDLLYGMVSKKTLMEIVKKLMVHMDKAEGTMYRDELLSKVIDICSQNNYQYITNFEWYMTVLVELTRMEGTRHGALVAAQMMDVAIRVSAVRAFAVAQMSSLLASPSPPLSQPSSRMAEMMFDEYSDRSSKIFNIKFSSRMPNHMKYLGLLAMSKILKTHPKSVQSHRDLIMQCLDDKDESIRLRALDLLYGMVSKKTLMEIVKKLMVHMDKAEGTMYRDELLSKVIDICSQNNYQYITNFE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKILKTHPKSVQSHRDLIMQCLDDKDESIRLRALDLLYGMVSKKTLMEIVKKLMVHMDKAEGTMYRDELLSKVIDICSQNNYQYITNFEWYMTVLVELTRMEGTRHGALVAAQMMDVAIRVSAVRAFAVAQMSSLLASPSPPLSQPSSRMAEMMFDEYSDRSSKIFNIKFSSRMPNHMKYLGLLAMSKILKTHPKSVQSHRDLIMQCLDDKDESIRLRALDLLYGMVSKKTLMEIVKKLMVHMDKAEGTMYRDELLSKVIDICSQNNYQYITNFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
AP-3 complex subunit delta-1 Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.confidentO54774
AP-3 complex subunit delta-1 Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.confidentO14617
AP-3 complex subunit delta-1 Part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.confidentQ865S1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0008565 [MF]protein transporter activityprobableGO:0005215, GO:0022892, GO:0003674
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0048490 [BP]anterograde synaptic vesicle transportprobableGO:0019226, GO:0035637, GO:0051649, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0097480, GO:0097479, GO:0051641, GO:0032501, GO:0050877, GO:0006810, GO:0044765, GO:0008150, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051640, GO:0003008, GO:0044700, GO:0016192, GO:0044707, GO:0044763, GO:0009987
GO:0048499 [BP]synaptic vesicle membrane organizationprobableGO:0016044, GO:0009987, GO:0010256, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0048007 [BP]antigen processing and presentation, exogenous lipid antigen via MHC class IbprobableGO:0002475, GO:0019882, GO:0019884, GO:0002376, GO:0008150, GO:0048003
GO:0008089 [BP]anterograde axon cargo transportprobableGO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0008088, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0044699, GO:0051641
GO:0033365 [BP]protein localization to organelleprobableGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030117 [CC]membrane coatprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0048475
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0006726 [BP]eye pigment biosynthetic processprobableGO:0032502, GO:0048069, GO:0044710, GO:0042440, GO:0042441, GO:0043474, GO:0043473, GO:0043324, GO:0048066, GO:0009058, GO:0008150, GO:0008152, GO:0046148, GO:0044699
GO:0005795 [CC]Golgi stackprobableGO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0008055 [BP]ocellus pigment biosynthetic processprobableGO:0043473, GO:0033060, GO:0044711, GO:0042440, GO:0043474, GO:0044550, GO:0019748, GO:0044710, GO:0009058, GO:0008150, GO:0044699, GO:0008152, GO:0046148, GO:0046158
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0061088 [BP]regulation of sequestering of zinc ionprobableGO:0032844, GO:2000021, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0050794
GO:0006829 [BP]zinc ion transportprobableGO:0006810, GO:0006812, GO:0006811, GO:0000041, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0051138 [BP]positive regulation of NK T cell differentiationprobableGO:0046638, GO:0046637, GO:0046635, GO:0046634, GO:0050863, GO:0045580, GO:0045582, GO:0050789, GO:0051249, GO:0050865, GO:0002684, GO:0002682, GO:0045621, GO:0065007, GO:0050867, GO:0051136, GO:0050793, GO:0050870, GO:0050794, GO:0045597, GO:0048518, GO:0045595, GO:0008150, GO:0051239, GO:0051094, GO:0051251, GO:1902107, GO:0002694, GO:1902105, GO:0002696, GO:2000026, GO:0045619, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain A
Confidence level:very confident
Coverage over the Query: 2-60,74-266
View the alignment between query and template
View the model in PyMOL
Template: 1U6G, chain C
Confidence level:probable
Coverage over the Query: 11-266
View the alignment between query and template
View the model in PyMOL