Diaphorina citri psyllid: psy16387

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670------

MGREGMGGAGNYGSANWNFHSTIDPEELFRNIFGQTGGFGGSQEGGFSEGFGFSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQLKERGENELLSVQRKLSVKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMISSQTRSHEQARQLTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKTKSSSSNVSREIVVTSSTRHVPLYCSQQPGKSFIYDKKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTVGSWGSTPNKNAKQRRKDSEAALKLLDSSLDLHCTGQNLSLCLLAFQLNIDTPVTLDYVLRHSM

ccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccCEEEEEEEHHHHHccccEEEEEccccccccccccccccccccccccccccccEEEEECccEEEEEcccccccccEEccccccccccccEEEEEEEEEEEcccccccccEEEEccccccccEEEEEEEccccccEECcccEEEEEEcHHHHHHcccCEEEccccccEEEEEEccccccccccCEEEEEcccccccccccEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccCEEEEccccccEEEEEccccccCEECcccccccccHHHHHHHHHHHHHHHHHHEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHcccccccccHHccccEEEEEEEcccccccccHHHccccc

**R********YGSANWNFHSTIDPEELFRNIFGQTGG**************FSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQL********************************QDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMIS***********LTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKT*************TSSTRHVPLYCSQQPGKS****KKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTVGSWG********************LDSSLDLHCTGQNLSLCLLAFQLNIDTPVTLDYVLRHS*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DnaJ homolog subfamily A member 3, mitochondrial	Modulates apoptotic signal transduction or effector structures within the mitochondrial matrix. Affect cytochrome C release from the mitochondria and caspase 3 activation, but not caspase 8 activation. Isoform 1 increases apoptosis triggered by both TNF and the DNA-damaging agent mytomycin C; in sharp contrast, isoform 2 suppresses apoptosis. Can modulate IFN-gamma-mediated transcriptional activity (By similarity). Isoform 2 may play a role in neuromuscular junction development as an effector of the MUSK signaling pathway.	confident	Q99M87
DnaJ homolog subfamily A member 3, mitochondrial	Modulates apoptotic signal transduction or effector structures within the mitochondrial matrix. Affect cytochrome C release from the mitochondria and caspase 3 activation, but not caspase 8 activation. Isoform 1 increases apoptosis triggered by both TNF and the DNA-damaging agent mytomycin C; in sharp contrast, isoform 2 suppresses apoptosis. Can modulate IFN-gamma-mediated transcriptional activity. Isoform 2 may play a role in neuromuscular junction development as an effector of the MUSK signaling pathway.	confident	Q96EY1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007528 [BP]	neuromuscular junction development	probable	GO:0050808, GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0071840, GO:0007517, GO:0048869, GO:0007519, GO:0016043, GO:0048513, GO:0044699, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0006457 [BP]	protein folding	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0042645 [CC]	mitochondrial nucleoid	probable	GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008285 [BP]	negative regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0043065 [BP]	positive regulation of apoptotic process	probable	GO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0006469 [BP]	negative regulation of protein kinase activity	probable	GO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0051348, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0031594 [CC]	neuromuscular junction	probable	GO:0005575, GO:0045202
GO:0051059 [MF]	NF-kappaB binding	probable	GO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0050821 [BP]	protein stabilization	probable	GO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0006919 [BP]	activation of cysteine-type endopeptidase activity involved in apoptotic process	probable	GO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0097202, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0043280, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0032088 [BP]	negative regulation of NF-kappaB transcription factor activity	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0043154 [BP]	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	probable	GO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0043086, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:0010259, GO:0006915, GO:0052547, GO:0052548, GO:0009987, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:0008150
GO:0060336 [BP]	negative regulation of interferon-gamma-mediated signaling pathway	probable	GO:0048585, GO:0048583, GO:0023057, GO:0065007, GO:0060759, GO:0023051, GO:0010646, GO:0050789, GO:0031347, GO:0009968, GO:0009966, GO:0002682, GO:0001960, GO:0048519, GO:0045088, GO:0050794, GO:0060330, GO:0060331, GO:0008150, GO:0060334, GO:0060761, GO:0050776, GO:0001959, GO:0080134, GO:0048523, GO:0010648
GO:0019897 [CC]	extrinsic to plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0031398 [BP]	positive regulation of protein ubiquitination	probable	GO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0008385 [CC]	IkappaB kinase complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0007264 [BP]	small GTPase mediated signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0019901 [MF]	protein kinase binding	probable	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0043124 [BP]	negative regulation of I-kappaB kinase/NF-kappaB cascade	probable	GO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0010627, GO:0010741, GO:0043122
GO:0005133 [MF]	interferon-gamma receptor binding	probable	GO:0005126, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0033256 [CC]	I-kappaB/NF-kappaB complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0034341 [BP]	response to interferon-gamma	probable	GO:0002376, GO:0034097, GO:0050896, GO:0045087, GO:0006952, GO:0006950, GO:0008150, GO:0006955, GO:0042221, GO:0010033
GO:0005083 [MF]	small GTPase regulator activity	probable	GO:0030695, GO:0030234, GO:0060589, GO:0003674
GO:0005884 [CC]	actin filament	probable	GO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045211 [CC]	postsynaptic membrane	probable	GO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NLT, chain A
Confidence level:very confident
Coverage over the Query: 51-268
View the alignment between query and template
View the model in PyMOL

Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 56-89,107-108,144-289
View the alignment between query and template
View the model in PyMOL

Template: 1U6G, chain C
Confidence level:confident
Coverage over the Query: 305-438
View the alignment between query and template
View the model in PyMOL

Template: 2QK1, chain A
Confidence level:confident
Coverage over the Query: 265-436
View the alignment between query and template
View the model in PyMOL

Template: 3UL1, chain B
Confidence level:probable
Coverage over the Query: 305-439,459-477
View the alignment between query and template
View the model in PyMOL