Psyllid ID: psy16387

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670------
MGREGMGGAGNYGSANWNFHSTIDPEELFRNIFGQTGGFGGSQEGGFSEGFGFSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQLKERGENELLSVQRKLSVKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMISSQTRSHEQARQLTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKTKSSSSNVSREIVVTSSTRHVPLYCSQQPGKSFIYDKKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTVGSWGSTPNKNAKQRRKDSEAALKLLDSSLDLHCTGQNLSLCLLAFQLNIDTPVTLDYVLRHSM
ccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccEEEEEEEEHHHHHccccEEEEEccccccccccccccccccccccccccccccEEEEEEccEEEEEcccccccccEEccccccccccccEEEEEEEEEEEcccccccccEEEEccccccccEEEEEEEccccccEEEcccEEEEEEcHHHHHHcccEEEEccccccEEEEEEccccccccccEEEEEEcccccccccccEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccEEEEEccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHccccccccHHHccccEEEEEEEcccccccccHHHccccc
ccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccEEEEEEEHHHHHcccEEEEEEccEEEcccccccccccccccccccccccccEEEEEccEEEEEEcccccccccEEEcccccccccccEEEEEEEEEEEEccccccccEEEEccccccccEEEEEEEEcccEEEEccccEEEEEEEEHHHHHccccEEEccccccEEEEEcccccHHHccccEEEEcccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEcEEEEcccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccEEEccccccHHHHcccccccccccccccccccccHHHHccHHHHHHHccccccccHHEEEEccc
mgregmggagnygsanwnfhstidpeELFRNIfgqtggfggsqeggfsegfgfsqpqEIIMKLTFTqaargvnkDVVLKIMDTctrchgekcepgtkaqkchycngtgletistgpfvmrstcryckgsrnliknpcttcdgkgqfaqrqtitvpvpagvedgqtvrmnvgkskKEIYITFRVeksdiferdgpdihsnaeiSLSQAvlggtiripgiyddqTVLFLEQgsvklsshqIMVKTGHKKFVKKEKARVKLRKSYktilpkgqnvtntefkVKRIVIREQLKERGENELLSVQRKLSVKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSildsvsplmldISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMISSQTRSHEQARQLTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKtkssssnvsrEIVVTsstrhvplycsqqpgksfiydkkitsnetldDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQqsgtvgvsWFKQTYARSIREHlykgrfpytvgswgstpnknakqRRKDSEAALKLLDSSldlhctgqnLSLCLLAFQlnidtpvtLDYVLRHSM
mgregmggagnygsanWNFHSTIDPEELFRNIFGQTGGFGGSQEGGFSEGFGFSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHgekcepgtkaqkchYCNGTGletistgpfvMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTItvpvpagvedgqtvrmnvgkskkeiyITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSvklsshqimvktghkkfvkkekarvklrksyktilpkgqnvtntefkvkRIVIReqlkergenellsvqrKLSVKELMSRLRhnnsavkqdglSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMISSQTRSHEQARqltvdldsrttttVFRIKVLTRLRSMLLAIVHLfktkssssnvsREIVVtsstrhvplycsqqpgksfiyDKKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPytvgswgstpnknakQRRKDSEAALKLLDSSLDLHCTGQNLSLCLLAFQLNIDTPVTLDYVLRHSM
MGREGMGGAGNYGSANWNFHSTIDPEELFRNIfgqtggfggsqeggfsegfgfsqPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHkkfvkkekarvkLRKSYKTILPKGQNVTNTEFKVKRIVIREQLKERGENELLSVQRKLSVKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMISSQTRSHEQARQLTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKTKSSSSNVSREIVVTSSTRHVPLYCSQQPGKSFIYDKKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTVGSWGSTPNKNAKQRRKdseaalklldssldlHCTGQNLSLCLLAFQLNIDTPVTLDYVLRHSM
***********YGSANWNFHSTIDPEELFRNIFGQTGGFGGSQEGGFSEGFGFSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQL********************************QDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMIS***********LTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKTK*******REIVVTSSTRHVPLYCSQQPGKSFIYDKKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTVGSWG******************KLLDSSLDLHCTGQNLSLCLLAFQLNIDTPVTLDYVL****
MGREG*****************IDPEELFRNIFG************************IIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVK*************************RKSYKTIL*********************************************************LSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDM*******************SRTTTTVFRIKVLTRLRSMLLAIV******************TSSTRHVPLYCSQQPGKS*************DDVQNYTQMLMPLLMETFIEV***************VALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTV****************************LDLHCTGQNLSLCLLAFQLNIDTPVTLDYVLRHS*
********AGNYGSANWNFHSTIDPEELFRNIFGQTGGFGGSQEGGFSEGFGFSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQLKERGENELLSVQRKLSVKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMISS*********QLTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKT*************TSSTRHVPLYCSQQPGKSFIYDKKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTVGSWGST************EAALKLLDSSLDLHCTGQNLSLCLLAFQLNIDTPVTLDYVLRHSM
**R**MGGAGNYGSANWNFHSTIDPEELFRNIFGQTGG**************FSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGE*****TKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQLK***************VKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMISSQTRSHEQARQLTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKTKSSSSNVSREIVVTSSTRHVPLYCSQQ********KKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTVGSWGSTPN****************LDSSLDLHCTGQNLSLCLLAFQLNIDTPVTLDYVLRH**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGREGMGGAGNYGSANWNFHSTIDPEELFRNIFGQTGGFGGSQEGGFSEGFGFSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQLKERGENELLSVQRKLSVKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISATTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCPILTANYRSLLPHFLDMISSQTRSHEQARQLTVDLDSRTTTTVFRIKVLTRLRSMLLAIVHLFKTKSSSSNVSREIVVTSSTRHVPLYCSQQPGKSFIYDKKITSNETLDDVQNYTQMLMPLLMETFIEVVADRKQAGSDIVVEAVALLQCVVDIILNVLHILQQSGTVGVSWFKQTYARSIREHLYKGRFPYTVGSWGSTPNKNAKQRRKDSEAALKLLDSSLDLHCTGQNLSLCLLAFQLNIDTPVTLDYVLRHSM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query676 2.2.26 [Sep-21-2011]
Q24331529 Protein tumorous imaginal N/A N/A 0.331 0.423 0.612 3e-76
Q27237520 Protein tumorous imaginal no N/A 0.329 0.428 0.591 1e-73
Q99M87480 DnaJ homolog subfamily A yes N/A 0.304 0.429 0.577 2e-68
Q96EY1480 DnaJ homolog subfamily A yes N/A 0.304 0.429 0.577 5e-67
Q8TA83456 DnaJ homolog dnj-10 OS=Ca yes N/A 0.321 0.475 0.408 6e-41
Q9NXF1 929 Testis-expressed sequence no N/A 0.525 0.382 0.311 3e-35
Q5RDK1 929 Testis-expressed sequence no N/A 0.525 0.382 0.309 7e-35
Q3URQ0 928 Testis-expressed sequence no N/A 0.526 0.383 0.294 3e-33
Q803M3 933 Testis-expressed sequence no N/A 0.569 0.412 0.283 3e-33
Q5ZM41 927 Testis-expressed sequence no N/A 0.514 0.375 0.291 3e-31
>sp|Q24331|TID_DROVI Protein tumorous imaginal discs, mitochondrial OS=Drosophila virilis GN=l(2)tid PE=2 SV=1 Back     alignment and function desciption
 Score =  286 bits (733), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 176/232 (75%), Gaps = 8/232 (3%)

Query: 14  SANWNFHSTIDPEELFRNIFGQTGGFGGSQEGGFSEG-FGFSQPQEIIMKLTFTQAARGV 72
           S NW F STIDPEELFR IFG+ G F  +    F++  FGF Q QE++M LTF QAARGV
Sbjct: 173 SQNWQFRSTIDPEELFRKIFGE-GNFRSNSFDDFADSKFGFGQAQELVMDLTFAQAARGV 231

Query: 73  NKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSRNL 132
           NKDV + ++D C +C G KCEPGTK  +C YCNGTG ETISTGPFVMRSTCRYC+G+R  
Sbjct: 232 NKDVNVNVVDQCPKCAGSKCEPGTKPGRCQYCNGTGFETISTGPFVMRSTCRYCQGTRQY 291

Query: 133 IKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSKKEIYITFRVEKSDIFERD 192
           IK PC  C+GKGQ  QR+ +TVPVPAG+E+GQTVRM VG   KE+++TFRVE+SD F RD
Sbjct: 292 IKYPCAECEGKGQTVQRRKVTVPVPAGIENGQTVRMQVG--SKELFVTFRVERSDYFRRD 349

Query: 193 GPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTG 244
           G D+H++A ISL+QAVLGGT+R+ G+Y+DQ  L +E G+   SSH+ +   G
Sbjct: 350 GADVHTDAPISLAQAVLGGTVRVQGVYEDQ-WLNIEPGT---SSHRKIALRG 397
May act as a tumor suppressor in larval imaginal disks.
Drosophila virilis (taxid: 7244)
>sp|Q27237|TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster GN=l(2)tid PE=1 SV=2 Back     alignment and function description
>sp|Q99M87|DNJA3_MOUSE DnaJ homolog subfamily A member 3, mitochondrial OS=Mus musculus GN=Dnaja3 PE=1 SV=1 Back     alignment and function description
>sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 Back     alignment and function description
>sp|Q8TA83|DNJ10_CAEEL DnaJ homolog dnj-10 OS=Caenorhabditis elegans GN=dnj-10 PE=4 SV=1 Back     alignment and function description
>sp|Q9NXF1|TEX10_HUMAN Testis-expressed sequence 10 protein OS=Homo sapiens GN=TEX10 PE=1 SV=2 Back     alignment and function description
>sp|Q5RDK1|TEX10_PONAB Testis-expressed sequence 10 protein OS=Pongo abelii GN=TEX10 PE=2 SV=1 Back     alignment and function description
>sp|Q3URQ0|TEX10_MOUSE Testis-expressed sequence 10 protein OS=Mus musculus GN=Tex10 PE=1 SV=1 Back     alignment and function description
>sp|Q803M3|TEX10_DANRE Testis-expressed sequence 10 protein homolog OS=Danio rerio GN=tex10 PE=2 SV=2 Back     alignment and function description
>sp|Q5ZM41|TEX10_CHICK Testis-expressed sequence 10 protein homolog OS=Gallus gallus GN=TEX10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query676
328702297626 PREDICTED: testis-expressed sequence 10 0.618 0.667 0.444 1e-86
158285436496 AGAP007565-PA [Anopheles gambiae str. PE 0.393 0.536 0.557 2e-80
158285438574 AGAP007565-PB [Anopheles gambiae str. PE 0.331 0.390 0.632 1e-79
157128157491 chaperone protein dnaj [Aedes aegypti] g 0.326 0.450 0.647 1e-79
242021082452 protein tumorous imaginal discs, putativ 0.315 0.471 0.633 3e-79
289740787501 molecular chaperone [Glossina morsitans 0.350 0.473 0.592 3e-79
350410070529 PREDICTED: protein tumorous imaginal dis 0.313 0.400 0.645 5e-79
195119326512 GI19741 [Drosophila mojavensis] gi|19390 0.328 0.433 0.613 1e-78
195026816504 GH21307 [Drosophila grimshawi] gi|193902 0.331 0.444 0.594 2e-78
328793508520 PREDICTED: protein tumorous imaginal dis 0.321 0.417 0.614 4e-78
>gi|328702297|ref|XP_001948368.2| PREDICTED: testis-expressed sequence 10 protein homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  327 bits (838), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 286/436 (65%), Gaps = 18/436 (4%)

Query: 240 MVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQLKERGENELLSV 299
           MVK+G +KFVKKEKA+V L+ ++KT+LPKGQNVT+T FKV++IV+  QLKERG++E+LS 
Sbjct: 1   MVKSGKRKFVKKEKAKVHLKVAHKTLLPKGQNVTDTNFKVRKIVLHGQLKERGDHEILS- 59

Query: 300 QRKLSVKELMSRLRHNNSAVKQDGLSGLLEIITLNPTSVIKSHFSSILDSVSPLMLDISA 359
           +  L++KEL+SRL H+N   +Q GL GL++++   P   +  H SS L++ S L LD  A
Sbjct: 60  KGNLNIKELLSRLNHHNMWQRQSGLEGLIDLVASYPPQTMAVHLSSFLEAASRLTLDGEA 119

Query: 360 TTRKAAVKLLSAMFSQVTEEELAPLFEIVVRYLACAMSHLDAGVREDSLLIIDVLLEQCP 419
             R+ AVKLLS++ + V E+++AP FEIV+RYLACAMSH+++ VRE SL ++DVL+ + P
Sbjct: 120 DIRQLAVKLLSSILTAVEEKQIAPSFEIVIRYLACAMSHINSAVRETSLNVLDVLITKHP 179

Query: 420 ILTANY--RSLLPHFLDMISSQTRSHEQARQLTVDLDSRTTTTVFRIKVLTRLRSMLLAI 477
            LTA +    +LP FLD+ISS+  S   +R+LTV ++  TTT+V+R+KVL  LRS+L AI
Sbjct: 180 KLTAVHCQTVVLPGFLDLISSKL-SDTTSRKLTVQINEHTTTSVWRLKVLNSLRSLLSAI 238

Query: 478 VHLFKTKS-SSSNVSREIVVTSSTR-HVPLY--CSQQPGK-SFIYDKKITSNETLDDVQN 532
           V     +S +SS+++R +    S R HVPLY   S + G   F   +K   N +  ++QN
Sbjct: 239 VKNTSLRSENSSDLNRTVNWKDSCRLHVPLYNSISLKTGPLDFNIFQKAEKNSSTTEIQN 298

Query: 533 YTQMLMPLLMETFIEVVADRKQ--AGSDIVVEAVALLQCVVDIILNVLHILQQSGTVG-- 588
           YT  LMPLL++TFIEV   +++    S+I ++  ++L+C++DIIL +  I Q S      
Sbjct: 299 YTASLMPLLIDTFIEVAPSKRENKNSSEISLQTASILKCILDIILLLWKIFQNSDNPSEM 358

Query: 589 VSWFKQTYARSIREHLYKGRFPY-TVGSWGSTPNKNAKQRRKDSEAALKLLDSSL---DL 644
           ++WF   Y   I +      FPY T+ S G T +K  K+ + D++  L L   S+   D 
Sbjct: 359 MAWFSINYGPKICQTFISNGFPYITLNSGGRTSDK-VKKHKTDTDVVLDLFGDSMVQSDT 417

Query: 645 HCTGQNLSLCLLAFQL 660
            C+ QN+ LCL+ F L
Sbjct: 418 KCSKQNIDLCLVYFLL 433

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158285436|ref|XP_001687891.1| AGAP007565-PA [Anopheles gambiae str. PEST] gi|157019991|gb|EDO64540.1| AGAP007565-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158285438|ref|XP_308308.4| AGAP007565-PB [Anopheles gambiae str. PEST] gi|157019992|gb|EAA04743.4| AGAP007565-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157128157|ref|XP_001661333.1| chaperone protein dnaj [Aedes aegypti] gi|108872682|gb|EAT36907.1| AAEL011055-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|242021082|ref|XP_002430975.1| protein tumorous imaginal discs, putative [Pediculus humanus corporis] gi|212516199|gb|EEB18237.1| protein tumorous imaginal discs, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|289740787|gb|ADD19141.1| molecular chaperone [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|350410070|ref|XP_003488936.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195119326|ref|XP_002004182.1| GI19741 [Drosophila mojavensis] gi|193909250|gb|EDW08117.1| GI19741 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195026816|ref|XP_001986341.1| GH21307 [Drosophila grimshawi] gi|193902341|gb|EDW01208.1| GH21307 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|328793508|ref|XP_394833.2| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query676
FB|FBgn0002174520 l(2)tid "lethal (2) tumorous i 0.350 0.455 0.54 1.8e-69
UNIPROTKB|F1NNE0393 DNAJA3 "Uncharacterized protei 0.307 0.529 0.574 7.1e-61
RGD|1306527480 Dnaja3 "DnaJ (Hsp40) homolog, 0.304 0.429 0.549 1.3e-59
UNIPROTKB|G3V6I5480 Dnaja3 "RCG49803, isoform CRA_ 0.304 0.429 0.549 1.3e-59
UNIPROTKB|G3V9U3453 Dnaja3 "Protein Dnaja3" [Rattu 0.304 0.454 0.549 1.3e-59
UNIPROTKB|E2R511480 DNAJA3 "Uncharacterized protei 0.304 0.429 0.549 1.7e-59
UNIPROTKB|J9P8P4453 DNAJA3 "Uncharacterized protei 0.304 0.454 0.549 1.7e-59
UNIPROTKB|A1A4J9453 DNAJA3 "DnaJ (Hsp40) homolog, 0.304 0.454 0.549 2.2e-59
MGI|MGI:1933786480 Dnaja3 "DnaJ (Hsp40) homolog, 0.304 0.429 0.539 5.7e-59
UNIPROTKB|I3LLG4476 DNAJA3 "Uncharacterized protei 0.313 0.445 0.536 1.9e-58
FB|FBgn0002174 l(2)tid "lethal (2) tumorous imaginal discs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 704 (252.9 bits), Expect = 1.8e-69, P = 1.8e-69
 Identities = 135/250 (54%), Positives = 176/250 (70%)

Query:     1 MGREGMG----GAGNYG----SANWNFHSTIDPEELFRNIXXXXXXXXXXXXXXXXXXXX 52
             +GR+G G    GAG +G    S +W F S+IDPEELFR I                    
Sbjct:   136 IGRQGGGFPGGGAGGFGPEGFSQSWQFRSSIDPEELFRKIFGEGNFRTNSFDDFADSKFG 195

Query:    53 XXXPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETI 112
                 QE++M LTF QAARGVNKDV + ++D C +C G KCEPGTK  +C YCNGTG ET+
Sbjct:   196 FGQAQEMVMDLTFAQAARGVNKDVNVNVVDQCPKCAGTKCEPGTKPGRCQYCNGTGFETV 255

Query:   113 STGPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGK 172
             STGPFVMRSTCRYC+G+R  IK PC+ C+GKG+  QR+ +TVPVPAG+E+GQTVRM VG 
Sbjct:   256 STGPFVMRSTCRYCQGTRQHIKYPCSECEGKGRTVQRRKVTVPVPAGIENGQTVRMQVGS 315

Query:   173 SKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSV 232
               KE+++TFRVE+SD F R+G D+H++A ISL+QAVLGGT+R+ G+Y+DQ +  +E G+ 
Sbjct:   316 --KELFVTFRVERSDYFRREGADVHTDAAISLAQAVLGGTVRVQGVYEDQWIN-VEPGTS 372

Query:   233 KLSSHQIMVK 242
               S H+IM++
Sbjct:   373 --SHHKIMLR 380
GO:0005739 "mitochondrion" evidence=ISS;IDA
GO:0005829 "cytosol" evidence=IDA
GO:0007224 "smoothened signaling pathway" evidence=IGI;IPI
GO:0005113 "patched binding" evidence=IPI
GO:0009408 "response to heat" evidence=IEA
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
UNIPROTKB|F1NNE0 DNAJA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1306527 Dnaja3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6I5 Dnaja3 "RCG49803, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9U3 Dnaja3 "Protein Dnaja3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R511 DNAJA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8P4 DNAJA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4J9 DNAJA3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1933786 Dnaja3 "DnaJ (Hsp40) homolog, subfamily A, member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLG4 DNAJA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96EY1DNJA3_HUMANNo assigned EC number0.57740.30470.4291yesN/A
Q99M87DNJA3_MOUSENo assigned EC number0.57740.30470.4291yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query676
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-48
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-47
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 1e-45
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 4e-45
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 3e-42
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-41
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 8e-38
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 5e-37
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 9e-37
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 1e-36
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-34
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-32
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 3e-32
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 6e-31
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 1e-29
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 4e-29
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 5e-29
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 6e-28
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 8e-27
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-26
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-25
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-25
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-24
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 8e-24
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 8e-23
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 5e-21
cd10747158 cd10747, DnaJ_C, C-terminal substrate binding doma 2e-20
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 5e-20
cd1071965 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H 1e-19
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 1e-18
pfam0068465 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain 4e-18
pfam1233386 pfam12333, Ipi1_N, Rix1 complex component involved 4e-15
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 9e-15
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-07
PLN03165111 PLN03165, PLN03165, chaperone protein dnaJ-related 2e-04
pfam0155681 pfam01556, DnaJ_C, DnaJ C terminal domain 0.001
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information 
 Score =  173 bits (441), Expect = 2e-48
 Identities = 83/243 (34%), Positives = 118/243 (48%), Gaps = 28/243 (11%)

Query: 1   MGREGMGGAGNYGSANWNFHSTIDPEELFRNIFGQTGGFGGSQEGGFSEGFGFSQPQEII 60
            G  G  G G  G   +N    I     F +IFG   G GG        G G  +     
Sbjct: 64  FGHAGFNGGGGGGGGGFNG-FDIGFFGDFGDIFGDFFGGGG--------GSGRRRRSGPR 114

Query: 61  --------MKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETI 112
                   ++LTF +A  GV K++ +   ++C  CHG   +PGT  + C  C GTG    
Sbjct: 115 RGEDLRYDLELTFEEAVFGVEKEIEIPRKESCETCHGTGAKPGTDPKTCPTCGGTGQVRR 174

Query: 113 STGP----FVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRM 168
             G     F  + TC  C G   +IK PC+TC GKG+  +R+TITV +PAGV+ GQ +R+
Sbjct: 175 QQGTPFGFFQQQQTCPTCGGEGKIIKEPCSTCKGKGRVKERKTITVKIPAGVDTGQRLRV 234

Query: 169 N-------VGKSKKEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDD 221
           +        G    ++Y+  RV+   IFERDG D++    IS +QA+LGG I +P +  D
Sbjct: 235 SGKGNAGENGGPNGDLYVVIRVKPHKIFERDGNDLYIEVPISFTQAILGGEIEVPTLDGD 294

Query: 222 QTV 224
             +
Sbjct: 295 VKL 297

This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family. Length = 354
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain Back     alignment and domain information
>gnl|CDD|221535 pfam12333, Ipi1_N, Rix1 complex component involved in 60S ribosome maturation Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|178709 PLN03165, PLN03165, chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 676
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 100.0
PRK14296372 chaperone protein DnaJ; Provisional 100.0
PRK14286372 chaperone protein DnaJ; Provisional 100.0
PRK14280376 chaperone protein DnaJ; Provisional 100.0
PRK14288369 chaperone protein DnaJ; Provisional 100.0
PRK14285365 chaperone protein DnaJ; Provisional 100.0
PRK14298377 chaperone protein DnaJ; Provisional 100.0
PRK14301373 chaperone protein DnaJ; Provisional 100.0
PRK14278378 chaperone protein DnaJ; Provisional 100.0
PRK14276380 chaperone protein DnaJ; Provisional 100.0
PRK14284391 chaperone protein DnaJ; Provisional 100.0
PRK14279392 chaperone protein DnaJ; Provisional 100.0
PRK14297380 chaperone protein DnaJ; Provisional 100.0
PTZ00037421 DnaJ_C chaperone protein; Provisional 100.0
PRK14277386 chaperone protein DnaJ; Provisional 100.0
PRK14287371 chaperone protein DnaJ; Provisional 100.0
PRK14295389 chaperone protein DnaJ; Provisional 100.0
PRK14281397 chaperone protein DnaJ; Provisional 100.0
PRK14294366 chaperone protein DnaJ; Provisional 100.0
PRK10767371 chaperone protein DnaJ; Provisional 100.0
PRK14300372 chaperone protein DnaJ; Provisional 100.0
PRK14291382 chaperone protein DnaJ; Provisional 100.0
PRK14282369 chaperone protein DnaJ; Provisional 100.0
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 100.0
PRK14290365 chaperone protein DnaJ; Provisional 100.0
PRK14293374 chaperone protein DnaJ; Provisional 100.0
PRK14289386 chaperone protein DnaJ; Provisional 100.0
PRK14292371 chaperone protein DnaJ; Provisional 100.0
PRK14283378 chaperone protein DnaJ; Provisional 100.0
KOG2149|consensus393 100.0
KOG0712|consensus337 100.0
PRK14299291 chaperone protein DnaJ; Provisional 99.98
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.97
TIGR03835871 termin_org_DnaJ terminal organelle assembly protei 99.94
PF12333102 Ipi1_N: Rix1 complex component involved in 60S rib 99.92
KOG0715|consensus288 99.73
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 99.59
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.39
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 99.38
KOG0713|consensus336 99.25
PRK14289386 chaperone protein DnaJ; Provisional 99.11
PRK14279392 chaperone protein DnaJ; Provisional 99.04
PRK14301373 chaperone protein DnaJ; Provisional 99.02
PRK10767371 chaperone protein DnaJ; Provisional 99.01
PRK14287371 chaperone protein DnaJ; Provisional 98.94
PRK14285365 chaperone protein DnaJ; Provisional 98.83
PRK14297380 chaperone protein DnaJ; Provisional 98.82
PRK14290365 chaperone protein DnaJ; Provisional 98.81
PRK14296372 chaperone protein DnaJ; Provisional 98.8
PRK14283378 chaperone protein DnaJ; Provisional 98.79
PRK14286372 chaperone protein DnaJ; Provisional 98.78
PLN03165111 chaperone protein dnaJ-related; Provisional 98.78
PRK14282369 chaperone protein DnaJ; Provisional 98.78
PRK14280376 chaperone protein DnaJ; Provisional 98.77
PRK14276380 chaperone protein DnaJ; Provisional 98.76
PRK14293374 chaperone protein DnaJ; Provisional 98.76
PRK14295389 chaperone protein DnaJ; Provisional 98.76
PRK14278378 chaperone protein DnaJ; Provisional 98.75
PRK14298377 chaperone protein DnaJ; Provisional 98.75
PRK14277386 chaperone protein DnaJ; Provisional 98.72
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 98.7
PRK14284391 chaperone protein DnaJ; Provisional 98.69
PRK14300372 chaperone protein DnaJ; Provisional 98.68
PRK14294366 chaperone protein DnaJ; Provisional 98.68
PRK14291382 chaperone protein DnaJ; Provisional 98.63
PRK14281397 chaperone protein DnaJ; Provisional 98.61
PRK14288369 chaperone protein DnaJ; Provisional 98.58
PRK14292371 chaperone protein DnaJ; Provisional 98.54
PTZ00037421 DnaJ_C chaperone protein; Provisional 98.47
PRK14299291 chaperone protein DnaJ; Provisional 98.32
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 98.17
PRK10266306 curved DNA-binding protein CbpA; Provisional 98.06
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 97.82
PF0155681 CTDII: DnaJ C terminal domain; InterPro: IPR002939 97.75
KOG0714|consensus306 97.64
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 97.22
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.92
KOG0712|consensus337 96.77
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.77
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.57
KOG2813|consensus406 96.19
COG1107715 Archaea-specific RecJ-like exonuclease, contains D 96.19
TIGR03835871 termin_org_DnaJ terminal organelle assembly protei 96.09
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 95.97
KOG2023|consensus 885 95.84
PLN03165111 chaperone protein dnaJ-related; Provisional 95.82
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 95.65
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 95.42
KOG2813|consensus406 94.94
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 94.36
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 93.96
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 93.9
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 93.61
KOG0715|consensus288 93.26
KOG2956|consensus516 92.41
PF08167165 RIX1: rRNA processing/ribosome biogenesis 92.27
KOG2023|consensus 885 92.02
KOG2171|consensus 1075 91.02
KOG0915|consensus 1702 90.49
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 90.13
KOG2032|consensus533 89.96
KOG1242|consensus569 88.61
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 88.49
KOG1824|consensus 1233 88.27
KOG1820|consensus 815 87.98
KOG1248|consensus1176 87.78
KOG2824|consensus281 87.78
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 87.68
PF1036392 DUF2435: Protein of unknown function (DUF2435) 86.99
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 86.25
PTZ00429 746 beta-adaptin; Provisional 86.21
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 86.17
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 85.83
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 85.74
KOG1248|consensus1176 85.69
PRK09687280 putative lyase; Provisional 85.41
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 85.37
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 85.34
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 85.13
KOG2824|consensus281 85.01
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 84.26
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 83.86
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 83.54
KOG0803|consensus 1312 83.14
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 82.87
PF08767319 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 81.84
PRK147141337 DNA polymerase II large subunit; Provisional 81.39
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 81.19
KOG2956|consensus516 81.13
KOG0212|consensus 675 80.43
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.3e-59  Score=496.69  Aligned_cols=253  Identities=30%  Similarity=0.579  Sum_probs=234.7

Q ss_pred             ChhhHhHhhhCCCCCCCCCCCCCCCCCCCCCCCeEEEEeeeHHhHhcCceeeeeeeeeeecCCCCCCCcCCCCcceeccc
Q psy16387         24 DPEELFRNIFGQTGGFGGSQEGGFSEGFGFSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHY  103 (676)
Q Consensus        24 d~~diF~~fFGg~~~fgg~~f~~~~~~~~~g~d~~~~l~lsLee~~~G~~k~i~~~r~~~C~~C~GtG~~~g~~~~~C~~  103 (676)
                      ||.|||++||||+++ +.    ...+++.+|.|+.+.++|||+|||.|+++++.+++...|+.|+|+|+++|+.+.+|++
T Consensus        90 ~~~DIF~~~FgGg~~-~~----~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~tC~t  164 (371)
T COG0484          90 DFGDIFEDFFGGGGG-GR----RRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPT  164 (371)
T ss_pred             CHHHHHHHhhcCCCc-cc----CCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCCcCCC
Confidence            799999999974211 11    1122456899999999999999999999999999999999999999999999999999


Q ss_pred             cCceeEEEEee--CCceeeEeCCCCCCcceEecccCCCCCCCceeeeeeEEEEEeCCCCcCCcEEEEcc-------ccCC
Q psy16387        104 CNGTGLETIST--GPFVMRSTCRYCKGSRNLIKNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNV-------GKSK  174 (676)
Q Consensus       104 C~G~G~~~~~~--G~~~~~~~C~~C~G~G~~i~~~C~~C~G~G~v~~~~~l~V~IP~Gv~~G~~irl~g-------G~~~  174 (676)
                      |+|+|++++.+  |.|+++++|+.|+|+|++|+++|+.|+|.|++++.++++|+||||+.+|++||++|       |+++
T Consensus       165 C~G~G~v~~~~~~g~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~G~~g~~Ggp~  244 (371)
T COG0484         165 CNGSGQVRTVQRTGFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGPNGGPA  244 (371)
T ss_pred             CCCcCeEEEEEeeeEEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecCcccCCCCCCC
Confidence            99999887766  88999999999999999999999999999999999999999999999999999996       5678


Q ss_pred             ccEEEEEEEecCCCccccCCCeeeeEeeCceeeecCcEEEeeecCCeEEEEecCCCCcccCCCcEEEEcCCccccccccc
Q psy16387        175 KEIYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFLEQGSVKLSSHQIMVKTGHKKFVKKEKA  254 (676)
Q Consensus       175 GDL~v~i~vk~h~~F~R~G~DL~~~~~Isl~eAllG~~i~v~tldG~~~v~Ip~~~~~gt~~g~~lrl~G~G~p~~~~~~  254 (676)
                      |||||+|.|++|+.|+|+|+|||++++|++.+|++|++++||||+|+++|+||+    |||+|+++||+|+|||..++..
T Consensus       245 GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~vptl~g~~~l~ip~----Gtq~G~~~rl~gkG~p~~~~~~  320 (371)
T COG0484         245 GDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIEVPTLDGRVKLKIPA----GTQTGEVFRLRGKGMPKLRSGG  320 (371)
T ss_pred             ccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEEEEecCCCEEEecCC----CCccCcEEEEcCCCccccCCCC
Confidence            999999999999999999999999999999999999999999999999999999    9999999999999999888888


Q ss_pred             cccccceecccccCCCCCchhhHHHHHHHHHHHHHHc
Q psy16387        255 RVKLRKSYKTILPKGQNVTNTEFKVKRIVIREQLKER  291 (676)
Q Consensus       255 rGDL~V~~~V~~Pk~~nlTdt~fksk~i~l~~q~~~~  291 (676)
                      +|||+|++.|..|+  ++++.+    +.+|.++....
T Consensus       321 ~GDl~v~v~v~~P~--~ls~~q----~~lL~~~~~~~  351 (371)
T COG0484         321 RGDLYVRVKVETPK--NLSDEQ----KELLEEFAKSL  351 (371)
T ss_pred             cCCEEEEEEEEcCC--CCCHHH----HHHHHHHHHhh
Confidence            89999999999999  899999    88888887654

>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG2149|consensus Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PF12333 Ipi1_N: Rix1 complex component involved in 60S ribosome maturation; InterPro: IPR024679 This domain is found in IPI1, which is a component of the Rix1 complex involved in pre-rRNA-processing [, ] Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2813|consensus Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2813|consensus Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>KOG2824|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2824|consensus Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG0803|consensus Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PF08767 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES) Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query676
2ctt_A104 Solution Structure Of Zinc Finger Domain From Human 1e-28
1exk_A79 Solution Structure Of The Cysteine-Rich Domain Of T 6e-10
1nlt_A248 The Crystal Structure Of Hsp40 Ydj1 Length = 248 6e-10
>pdb|2CTT|A Chain A, Solution Structure Of Zinc Finger Domain From Human Dnaj Subfamily A Menber 3 Length = 104 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (76%)
Query: 61  MKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMR 120
           M+LTF QAA+GVNK+  + IMDTC RC+G+  EPGTK Q CHYC G+G+ETI+TGPFVMR
Sbjct: 8   MELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMR 67
Query: 121 STCRYCKGSRNLIKNPCTTCDGKGQFAQRQ 150
           STCR C G  ++I +PC  C G GQ  Q++
Sbjct: 68  STCRRCGGRGSIIISPCVVCRGAGQAKQKK 97
>pdb|1EXK|A Chain A, Solution Structure Of The Cysteine-Rich Domain Of The Escherichia Coli Chaperone Protein Dnaj Length = 79 Back     alignment and structure
>pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query676
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 2e-38
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 2e-27
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 6e-21
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 2e-20
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 8e-16
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 3e-12
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 3e-07
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 5e-06
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 4e-07
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 1e-05
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 3e-05
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 3e-04
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 Back     alignment and structure
 Score =  141 bits (359), Expect = 2e-38
 Identities = 49/205 (23%), Positives = 90/205 (43%), Gaps = 23/205 (11%)

Query: 61  MKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETIS--TGPFV 118
           +  +  +  +G    + L     C  C G   + G   +KC  CNG G++ ++   GP +
Sbjct: 18  ISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAV-KKCTSCNGQGIKFVTRQMGPMI 76

Query: 119 MR--STCRYCKGSRNLI--KNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNVGKSK 174
            R  + C  C G+ ++I  K+ C +C+GK    +R+ + V V  G++DGQ +    G++ 
Sbjct: 77  QRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFK-GEAD 135

Query: 175 KE-------IYITFRVEKSDIFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDDQTVLFL 227
           +        +           F+RDG D+   AEI L  A+ GG   +  +  D   + +
Sbjct: 136 QAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGI 195

Query: 228 EQGSVKLSSHQIMVKTGHKKFVKKE 252
             G V        +  G +K ++ +
Sbjct: 196 VPGEV--------IAPGMRKVIEGK 212
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Length = 249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query676
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 100.0
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 100.0
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 100.0
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 100.0
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 100.0
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 99.86
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 99.83
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 99.76
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 99.55
1nlt_A248 Protein YDJ1, mitochondrial protein import protein 98.79
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 98.11
3i38_A109 Putative chaperone DNAJ; structural genomics, prot 98.1
1c3g_A170 Heat shock protein 40; beta sheets, short helices, 97.97
2q2g_A180 HSP40 protein, heat shock 40 kDa protein, putative 97.97
1xao_A121 YDJ1, mitochondrial protein import protein MAS5; b 97.89
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.87
3agx_A181 DNAJ homolog subfamily B member 1; chaperone; 1.85 97.82
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.79
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 97.75
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.66
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.61
3pmq_A669 Decaheme cytochrome C MTRF; greek KEY, C type cyto 97.56
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.29
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 97.14
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 97.13
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 96.47
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 96.44
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 96.35
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 96.29
1qgr_A 876 Protein (importin beta subunit); transport recepto 96.26
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 96.26
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 96.1
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 96.01
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 95.89
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 95.59
1qgr_A 876 Protein (importin beta subunit); transport recepto 95.57
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 95.57
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 95.53
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 95.3
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 94.63
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 94.52
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 94.37
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 94.16
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 93.93
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 93.73
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 93.7
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 93.38
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 93.28
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 93.22
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 93.1
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 92.91
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 92.72
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 92.65
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 92.27
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 92.2
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 92.09
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 91.78
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 91.08
2x19_B 963 Importin-13; nuclear transport, protein transport; 90.79
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 90.64
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 89.31
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 88.21
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 88.17
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 87.65
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 87.23
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 87.16
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 87.06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 86.36
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 84.89
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 84.87
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 84.81
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 84.73
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 82.49
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 82.23
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 81.49
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
Probab=100.00  E-value=6.7e-52  Score=426.38  Aligned_cols=221  Identities=22%  Similarity=0.418  Sum_probs=199.5

Q ss_pred             CCCCCCeEEEEeeeHHhHhcCceeeeeeeeeeecCCCCCCCcCCCCcceeccccCceeEEE--EeeCCce--eeEeCCCC
Q psy16387         51 FGFSQPQEIIMKLTFTQAARGVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLET--ISTGPFV--MRSTCRYC  126 (676)
Q Consensus        51 ~~~g~d~~~~l~lsLee~~~G~~k~i~~~r~~~C~~C~GtG~~~g~~~~~C~~C~G~G~~~--~~~G~~~--~~~~C~~C  126 (676)
                      +.+|+|+.++|+|||||||+|+++++.+++.+.|+.|+|+|++++. ..+|+.|+|+|+++  +++|||+  .+++|+.|
T Consensus         8 ~~~g~d~~~~l~vslee~~~G~~k~i~~~r~~~C~~C~G~G~~~g~-~~~C~~C~G~G~~~~~~~~g~~~~~~~~~C~~C   86 (248)
T 1nlt_A            8 PQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA-VKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVC   86 (248)
T ss_dssp             CCBCCCEEEEEEECTTHHHHCEEEEEEEEEEEECTTTTTCSBSTTT-CCCCTTSSSSSCEEEEEESSSEEEEEECSCTTC
T ss_pred             CCCCCCEEEEEEecHHHhcCCceEEEEeeEEEeCCCCcCccCCCCC-CccCCCCCCCcEEEEEEecCceEEEEEEcCCCC
Confidence            4579999999999999999999999999999999999999999988 59999999999753  4568853  67899999


Q ss_pred             CCcceEe--cccCCCCCCCceeeeeeEEEEEeCCCCcCCcEEEEcc------ccCCccEEEEEEEecCCCccccCCCeee
Q psy16387        127 KGSRNLI--KNPCTTCDGKGQFAQRQTITVPVPAGVEDGQTVRMNV------GKSKKEIYITFRVEKSDIFERDGPDIHS  198 (676)
Q Consensus       127 ~G~G~~i--~~~C~~C~G~G~v~~~~~l~V~IP~Gv~~G~~irl~g------G~~~GDL~v~i~vk~h~~F~R~G~DL~~  198 (676)
                      +|+|++|  +++|+.|+|.|++++.++++|+||||+++|++|+|+|      ++++|||||+|+++||+.|+|+|+|||+
T Consensus        87 ~G~G~~i~~~~~C~~C~G~g~~~~~~~l~V~Ip~G~~~G~~ir~~g~G~~~~~g~~GDl~v~i~v~~h~~F~R~G~DL~~  166 (248)
T 1nlt_A           87 HGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVY  166 (248)
T ss_dssp             SSSSSCCCTTSBCSSSTTSCEEEEEEEEEEEECTTCCTTCEEEETTCSCCCTTCBCCCEEEEEEECCCSSCEEETTEEEE
T ss_pred             CCcCEEeccCCCCcccCCCceEeeeEEEEEEECCCccCCCEEEEeeeecCCCCCCcceEEEEEEEecCccceeeCCEEEE
Confidence            9999999  8999999999999999999999999999999999996      4578999999999999999999999999


Q ss_pred             eEeeCceeeecCcEEEeeecCCe-EEEEecCCCCcc--cCCCcEEEEcCCccccccccccccccceecccccCCCCCchh
Q psy16387        199 NAEISLSQAVLGGTIRIPGIYDD-QTVLFLEQGSVK--LSSHQIMVKTGHKKFVKKEKARVKLRKSYKTILPKGQNVTNT  275 (676)
Q Consensus       199 ~~~Isl~eAllG~~i~v~tldG~-~~v~Ip~~~~~g--t~~g~~lrl~G~G~p~~~~~~rGDL~V~~~V~~Pk~~nlTdt  275 (676)
                      +++|+|+||++|++++||||||+ ++|+||+    +  ++||++++|+|+|||..+...+|||||+|.|.+|+..++|++
T Consensus       167 ~~~Isl~eAllG~~i~v~tldG~~~~i~ip~----g~vt~~g~~~rl~g~Gmp~~~~~~~GDL~V~~~V~~P~~~~Ls~~  242 (248)
T 1nlt_A          167 EAEIDLLTAIAGGEFALEHVSGDWLKVGIVP----GEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKDPENHFTSEE  242 (248)
T ss_dssp             EEEEEHHHHHHCBCCEEECSSSCEEECCBCT----TTTCSTTCEEEETTCSCBCSSSCSBCCEEEEEEEECCC-------
T ss_pred             EEEeCHHHHhcCCEEEEeCCCCCEEEEEeCC----CCeeCCCeEEEEcCCCCccCCCCCcCCEEEEEEEECCCCCCCCHH
Confidence            99999999999999999999995 8999999    6  999999999999999765447899999999999995458888


Q ss_pred             h
Q psy16387        276 E  276 (676)
Q Consensus       276 ~  276 (676)
                      +
T Consensus       243 q  243 (248)
T 1nlt_A          243 N  243 (248)
T ss_dssp             -
T ss_pred             H
Confidence            7
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Back     alignment and structure
>2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 676
d1exka_79 g.54.1.1 (A:) Cysteine-rich domain of the chaperon 1e-15
d1m1qa_90 a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum 9e-13
d1nlta374 g.54.1.1 (A:139-212) Mitochondrial protein import 7e-12
d1nlta280 b.4.1.1 (A:258-337) Mitochondrial protein import p 3e-07
d1c3ga290 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba 2e-05
d1c3ga180 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba 1e-04
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: DnaJ/Hsp40 cysteine-rich domain
superfamily: DnaJ/Hsp40 cysteine-rich domain
family: DnaJ/Hsp40 cysteine-rich domain
domain: Cysteine-rich domain of the chaperone protein DnaJ
species: Escherichia coli [TaxId: 562]

 Score = 70.1 bits (171), Expect = 1e-15
 Identities = 29/75 (38%), Positives = 45/75 (60%)

Query: 71  GVNKDVVLKIMDTCTRCHGEKCEPGTKAQKCHYCNGTGLETISTGPFVMRSTCRYCKGSR 130
           GV K++ +  ++ C  CHG   +PGT+ Q C  C+G+G   +  G F ++ TC +C+G  
Sbjct: 1   GVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRG 60

Query: 131 NLIKNPCTTCDGKGQ 145
            LIK+PC  C G G+
Sbjct: 61  TLIKDPCNKCHGHGR 75
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query676
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.75
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 99.7
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 99.66
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 99.42
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.37
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 99.34
d1nlta174 Mitochondrial protein import protein mas5 (Hsp40, 99.05
d1c3ga180 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 98.16
d1c3ga290 Heat shock protein 40 Sis1 {Baker's yeast (Sacchar 97.92
d1nlta280 Mitochondrial protein import protein mas5 (Hsp40, 97.77
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 97.23
d1m1qa_90 Flavocytochrome c3 (respiratory fumarate reductase 97.05
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 96.9
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 95.62
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 95.28
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.25
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 94.81
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 94.8
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 93.31
d1b3ua_588 Constant regulatory domain of protein phosphatase 93.27
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 93.03
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 92.77
d1b3ua_588 Constant regulatory domain of protein phosphatase 92.45
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 92.12
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 90.28
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 89.99
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 89.48
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 88.76
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 88.67
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 87.79
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 87.34
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 84.49
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 84.1
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 83.89
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 83.81
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 83.73
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 81.73
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 81.14
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: HSP40/DnaJ peptide-binding domain
superfamily: HSP40/DnaJ peptide-binding domain
family: HSP40/DnaJ peptide-binding domain
domain: Heat shock protein 40 Sis1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.75  E-value=3.4e-19  Score=153.40  Aligned_cols=83  Identities=22%  Similarity=0.274  Sum_probs=77.9

Q ss_pred             CccccCCCeeeeEeeCceeeecCcEEEeeecCCe-EEEEecCCCCcccCCCcEEEEcCCcccccc-ccccccccceeccc
Q psy16387        188 IFERDGPDIHSNAEISLSQAVLGGTIRIPGIYDD-QTVLFLEQGSVKLSSHQIMVKTGHKKFVKK-EKARVKLRKSYKTI  265 (676)
Q Consensus       188 ~F~R~G~DL~~~~~Isl~eAllG~~i~v~tldG~-~~v~Ip~~~~~gt~~g~~lrl~G~G~p~~~-~~~rGDL~V~~~V~  265 (676)
                      .|+|+|+||+++++|++.||++|++++|+|+||+ ++|++|+    ++++|++++|+|+|||... .+.+|||+|+|.|.
T Consensus         1 ~F~R~G~DL~~~~~I~~~eal~G~~~~i~~~dG~~i~i~ip~----~~~~g~~~~i~g~G~p~~~~~~~rGdL~V~~~v~   76 (90)
T d1c3ga2           1 NFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQ----PVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVD   76 (90)
T ss_dssp             SEEEETTEEEEEECCBHHHHHHCEEEEEECSSSCEEEEEESS----CCCTTCEEECTTCSCBCSSCTTSBCCEEEEECCB
T ss_pred             CCeEeCCeEEEEEEeCHHHHhcCCeEEEecccccceeccccc----ccccccccccCCCCCCcCCCCCCcCCEEEEEEEE
Confidence            5999999999999999999999999999999995 7999999    9999999999999999754 56799999999999


Q ss_pred             ccCCCCCchhh
Q psy16387        266 LPKGQNVTNTE  276 (676)
Q Consensus       266 ~Pk~~nlTdt~  276 (676)
                      +|+  ++|+++
T Consensus        77 ~P~--~ls~~q   85 (90)
T d1c3ga2          77 YPI--SLNDAQ   85 (90)
T ss_dssp             CCS--SCCTTH
T ss_pred             cCC--CCCHHH
Confidence            999  788888
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure