Diaphorina citri psyllid: psy16395


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MRLLNKLIVVKPGLFYSHFISPFRQVFMDEVNQQKMLPTIRSYLKLYTTLPLSKLATFMGNARAGQDSEIERDVDKETKSLITHLLAFKHKMKNVVWTRGPSGLEGTFQSGSELDFYIDNEMIHIADTKVAHRYGDFFIRKIIKFEELNKKLQAIKI
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccEEEEEccccccccccEEEccccEEEECccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccc
***LNKLIVVKPGLFYSHFISPFRQVFMDEVNQQKMLPTIRSYLKLYTTLPLSKLATFMGNARA*********VDKETKSLITHLLAFKHKMKNVVWTRGPSGLEGTFQSGSELDFYIDNEMIHIADTKVAHRYGDFFIRKIIKFEELNKKLQAI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLLNKLIVVKPGLFYSHFISPFRQVFMDEVNQQKMLPTIRSYLKLYTTLPLSKLATFMGNARAGQDSEIERDVDKETKSLITHLLAFKHKMKNVVWTRGPSGLEGTFQSGSELDFYIDNEMIHIADTKVAHRYGDFFIRKIIKFEELNKKLQAIKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 3 subunit L Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.confidentQ7Q5Y8
Eukaryotic translation initiation factor 3 subunit L Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.confidentQ5F428
Eukaryotic translation initiation factor 3 subunit L Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.confidentQ9VTU4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005852 [CC]eukaryotic translation initiation factor 3 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0001650 [CC]fibrillar centerprobableGO:0005575, GO:0043232, GO:0031981, GO:0005730, GO:0005634, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0031974, GO:0044452, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain R
Confidence level:confident
Coverage over the Query: 25-61,77-89,110-127
View the alignment between query and template
View the model in PyMOL