Diaphorina citri psyllid: psy16399


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
FHPLSPPPSFTTGADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID
cccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEEc
*HP*************IPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FHPLSPPPSFTTGADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytoplasmic tRNA 2-thiolation protein 1 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated urm1 onto the uridine of tRNAs at wobble position.confidentQ5FW05
Cytoplasmic tRNA 2-thiolation protein 1 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation.confidentQ6C8R5
Cytoplasmic tRNA 2-thiolation protein 1 Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.confidentQ7JWW5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0002144 [CC]cytosolic tRNA wobble base thiouridylase complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0043412 [BP]macromolecule modificationprobableGO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WY5, chain A
Confidence level:confident
Coverage over the Query: 103-165
View the alignment between query and template
View the model in PyMOL
Template: 1NI5, chain A
Confidence level:confident
Coverage over the Query: 16-85
View the alignment between query and template
View the model in PyMOL