Psyllid ID: psy16399

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
FHPLSPPPSFTTGADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID
cccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEEc
ccccccccEEEccccccccccccHHHHHHHHHHHHHHHcccccccEccccHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEc
fhplspppsfttgadsiprckplkyAYEKEIVMYAYYKKLVYFStecifapnayrGHARTFLKHLEKirpasimdiIHSESkyieknpanfnrpktgdtlcKECFFHAFELEIHHTIVTNKLFEKHHRIAIaasggkdsTVLAHVLKVLNEKYQYGLDLVLLSID
fhplspppsfttgadsiprckPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIaasggkdsTVLAHVLKVLnekyqyglDLVLLSID
FHPLSPPPSFTTGADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID
****************IPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLS**
*HP*****************KPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID
**********TTGADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID
FHPLSPPPSFTTGADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FHPLSPPPSFTTGADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEKNPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query165 2.2.26 [Sep-21-2011]
B4KLL0 343 Cytoplasmic tRNA 2-thiola N/A N/A 0.454 0.218 0.734 2e-29
B4NN33 343 Cytoplasmic tRNA 2-thiola N/A N/A 0.454 0.218 0.759 2e-29
B4J5B3343 Cytoplasmic tRNA 2-thiola N/A N/A 0.545 0.262 0.659 2e-29
Q16QI1341 Cytoplasmic tRNA 2-thiola N/A N/A 0.539 0.260 0.677 4e-29
B4LM02 343 Cytoplasmic tRNA 2-thiola N/A N/A 0.454 0.218 0.721 5e-29
B3N7L9343 Cytoplasmic tRNA 2-thiola N/A N/A 0.545 0.262 0.648 5e-29
B4HSL7343 Cytoplasmic tRNA 2-thiola N/A N/A 0.545 0.262 0.659 6e-29
B3MI77343 Cytoplasmic tRNA 2-thiola N/A N/A 0.545 0.262 0.659 6e-29
Q5FW05341 Cytoplasmic tRNA 2-thiola yes N/A 0.593 0.287 0.607 7e-29
Q28ZC1343 Cytoplasmic tRNA 2-thiola yes N/A 0.545 0.262 0.670 9e-29
>sp|B4KLL0|CTU1_DROMO Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila mojavensis GN=GI19452 PE=3 SV=1 Back     alignment and function desciption
 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%)

Query: 87  NPANFNRPKTGDTLCKECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVL 146
           N A+  RPKTGD LCK+CFF AFE EIHHTI T+KLF +  ++A+AASGGKDSTVLAHVL
Sbjct: 11  NRASLKRPKTGDALCKDCFFAAFEAEIHHTITTSKLFRRGEKVAVAASGGKDSTVLAHVL 70

Query: 147 KVLNEKYQYGLDLVLLSID 165
           K+LNE++ YGLDLVLLSID
Sbjct: 71  KLLNERHNYGLDLVLLSID 89
Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.
Drosophila mojavensis (taxid: 7230)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: -
>sp|B4NN33|CTU1_DROWI Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila willistoni GN=GK22963 PE=3 SV=1 Back     alignment and function description
>sp|B4J5B3|CTU1_DROGR Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila grimshawi GN=GH20281 PE=3 SV=1 Back     alignment and function description
>sp|Q16QI1|CTU1_AEDAE Cytoplasmic tRNA 2-thiolation protein 1 OS=Aedes aegypti GN=AAEL011283 PE=3 SV=1 Back     alignment and function description
>sp|B4LM02|CTU1_DROVI Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila virilis GN=GJ21203 PE=3 SV=1 Back     alignment and function description
>sp|B3N7L9|CTU1_DROER Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila erecta GN=GG10584 PE=3 SV=1 Back     alignment and function description
>sp|B4HSL7|CTU1_DROSE Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila sechellia GN=GM20632 PE=3 SV=1 Back     alignment and function description
>sp|B3MI77|CTU1_DROAN Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila ananassae GN=GF12710 PE=3 SV=1 Back     alignment and function description
>sp|Q5FW05|CTU1_XENTR Cytoplasmic tRNA 2-thiolation protein 1 OS=Xenopus tropicalis GN=ctu1 PE=2 SV=1 Back     alignment and function description
>sp|Q28ZC1|CTU1_DROPS Cytoplasmic tRNA 2-thiolation protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA20807 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
66505934 343 PREDICTED: cytoplasmic tRNA 2-thiolation 0.587 0.282 0.657 2e-30
380030456 343 PREDICTED: cytoplasmic tRNA 2-thiolation 0.587 0.282 0.666 4e-30
332019893 339 Cytoplasmic tRNA 2-thiolation protein 1 0.545 0.265 0.731 1e-29
383857002 349 PREDICTED: cytoplasmic tRNA 2-thiolation 0.563 0.266 0.670 3e-29
307175621 336 ATP-binding domain-containing protein 3 0.587 0.288 0.628 7e-29
350398712 343 PREDICTED: cytoplasmic tRNA 2-thiolation 0.587 0.282 0.628 7e-29
340712086 343 PREDICTED: cytoplasmic tRNA 2-thiolation 0.587 0.282 0.628 7e-29
289742235 348 uncharacterized conserved protein [Gloss 0.478 0.227 0.762 8e-29
307209204 340 ATP-binding domain-containing protein 3 0.587 0.285 0.619 5e-28
195120392 343 GI19452 [Drosophila mojavensis] gi|22671 0.454 0.218 0.734 9e-28
>gi|66505934|ref|XP_397328.2| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Apis mellifera] Back     alignment and taxonomy information
 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/105 (65%), Positives = 79/105 (75%), Gaps = 8/105 (7%)

Query: 10  FTTGADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIR 69
            T GAD I RCKPLKYAYEKEIVMYAY+K+LVYFSTECIFAPNAYRGHARTFLK LEK+R
Sbjct: 195 ITAGADCIRRCKPLKYAYEKEIVMYAYFKQLVYFSTECIFAPNAYRGHARTFLKDLEKVR 254

Query: 70  PASIMDIIHS-ESKYIEKN---PANFNRPKTG----DTLCKECFF 106
           P+SI+DIIHS E+  I++N   P   N  + G      +CK C  
Sbjct: 255 PSSILDIIHSGETLQIKENIKLPERRNCSRCGFVSSQEICKACIM 299

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380030456|ref|XP_003698864.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|332019893|gb|EGI60354.1| Cytoplasmic tRNA 2-thiolation protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383857002|ref|XP_003703995.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307175621|gb|EFN65530.1| ATP-binding domain-containing protein 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350398712|ref|XP_003485283.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340712086|ref|XP_003394595.1| PREDICTED: cytoplasmic tRNA 2-thiolation protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|289742235|gb|ADD19865.1| uncharacterized conserved protein [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|307209204|gb|EFN86311.1| ATP-binding domain-containing protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195120392|ref|XP_002004711.1| GI19452 [Drosophila mojavensis] gi|226711419|sp|B4KLL0.1|CTU1_DROMO RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; AltName: Full=Cytoplasmic tRNA adenylyltransferase 1 gi|193909779|gb|EDW08646.1| GI19452 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query165
UNIPROTKB|B4J5B3343 GH20281 "Cytoplasmic tRNA 2-th 0.545 0.262 0.659 2.4e-28
UNIPROTKB|Q5FW05341 ctu1 "Cytoplasmic tRNA 2-thiol 0.581 0.281 0.619 3.1e-28
UNIPROTKB|B4KLL0343 GI19452 "Cytoplasmic tRNA 2-th 0.545 0.262 0.659 3.9e-28
UNIPROTKB|Q16QI1341 AAEL011283 "Cytoplasmic tRNA 2 0.539 0.260 0.677 3.9e-28
UNIPROTKB|B3MI77343 GF12710 "Cytoplasmic tRNA 2-th 0.545 0.262 0.659 5e-28
UNIPROTKB|B4GHY8343 GL16852 "Cytoplasmic tRNA 2-th 0.545 0.262 0.670 5e-28
UNIPROTKB|Q28ZC1343 GA20807 "Cytoplasmic tRNA 2-th 0.545 0.262 0.670 5e-28
UNIPROTKB|B3N7L9343 GG10584 "Cytoplasmic tRNA 2-th 0.545 0.262 0.648 5e-28
UNIPROTKB|B4HSL7343 GM20632 "Cytoplasmic tRNA 2-th 0.545 0.262 0.659 5e-28
UNIPROTKB|B4LM02343 GJ21203 "Cytoplasmic tRNA 2-th 0.557 0.268 0.649 6.4e-28
UNIPROTKB|B4J5B3 GH20281 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
 Score = 316 (116.3 bits), Expect = 2.4e-28, P = 2.4e-28
 Identities = 62/94 (65%), Positives = 74/94 (78%)

Query:    13 GADSIPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPAS 72
             G DSIPR KPLKY+YEKEIVMYA+YK+LVYFSTEC+FAPNAYRGHAR FLK LEK+RP+ 
Sbjct:   199 GEDSIPRVKPLKYSYEKEIVMYAHYKRLVYFSTECVFAPNAYRGHARAFLKDLEKVRPSV 258

Query:    73 IMDIIHSESKYIEKNPANFNRPKTGDTLCKECFF 106
             IMDII+S  +   K+ A   +P  G  +C+ C F
Sbjct:   259 IMDIIYSGEQLRFKDTAK--KPVRG--ICERCGF 288
GO:0000049 "tRNA binding" evidence=ISS
GO:0002098 "tRNA wobble uridine modification" evidence=ISS
GO:0005829 "cytosol" evidence=ISS
GO:0034227 "tRNA thio-modification" evidence=ISS
UNIPROTKB|Q5FW05 ctu1 "Cytoplasmic tRNA 2-thiolation protein 1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|B4KLL0 GI19452 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|Q16QI1 AAEL011283 "Cytoplasmic tRNA 2-thiolation protein 1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|B3MI77 GF12710 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4GHY8 GL16852 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|Q28ZC1 GA20807 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B3N7L9 GG10584 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4HSL7 GM20632 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4LM02 GJ21203 "Cytoplasmic tRNA 2-thiolation protein 1" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94480CTU1_DICDI2, ., 7, ., 7, ., -0.65330.44840.2055yesN/A
O76365CTU1_CAEEL2, ., 7, ., 7, ., -0.58220.42420.1876yesN/A
O64862CTU1_ARATH2, ., 7, ., 7, ., -0.67900.48480.2253yesN/A
Q6FMB5CTU1_CANGA2, ., 7, ., 7, ., -0.61030.46060.2122yesN/A
P0CS70CTU1_CRYNJ2, ., 7, ., 7, ., -0.67560.44240.2011yesN/A
Q5FW05CTU1_XENTR2, ., 7, ., 7, ., -0.60740.59390.2873yesN/A
Q6CWX6CTU1_KLULA2, ., 7, ., 7, ., -0.51510.55750.2479yesN/A
B5RV24CTU1_DEBHA2, ., 7, ., 7, ., -0.62330.46660.2042yesN/A
Q803X1CTU1_DANRE2, ., 7, ., 7, ., -0.51180.69690.3352yesN/A
Q6C8R5CTU1_YARLI2, ., 7, ., 7, ., -0.62330.45450.2054yesN/A
Q7Q9I4CTU1_ANOGA2, ., 7, ., 7, ., -0.64510.53930.2602yesN/A
O94282CTU1_SCHPO2, ., 7, ., 7, ., -0.60490.48480.2388yesN/A
Q28ZC1CTU1_DROPS2, ., 7, ., 7, ., -0.67020.54540.2623yesN/A
A3GGB3CTU1_PICST2, ., 7, ., 7, ., -0.520.56360.2473yesN/A
Q7JWW5CTU1_DROME2, ., 7, ., 7, ., -0.64890.54540.2623yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
cd01993 185 cd01993, Alpha_ANH_like_II, This is a subfamily of 8e-13
cd01993185 cd01993, Alpha_ANH_like_II, This is a subfamily of 2e-12
TIGR00269104 TIGR00269, TIGR00269, TIGR00269 family protein 3e-09
COG0037 298 COG0037, MesJ, tRNA(Ile)-lysidine synthase MesJ [C 1e-08
COG0037298 COG0037, MesJ, tRNA(Ile)-lysidine synthase MesJ [C 4e-07
cd01992 185 cd01992, PP-ATPase, N-terminal domain of predicted 1e-04
TIGR02432 189 TIGR02432, lysidine_TilS_N, tRNA(Ile)-lysidine syn 3e-04
pfam01171 182 pfam01171, ATP_bind_3, PP-loop family 0.001
cd01986103 cd01986, Alpha_ANH_like, Adenine nucleotide alpha 0.004
>gnl|CDD|238951 cd01993, Alpha_ANH_like_II, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information 
 Score = 62.6 bits (153), Expect = 8e-13
 Identities = 22/38 (57%), Positives = 27/38 (71%)

Query: 128 RIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID 165
           RI +A SGGKDS VL HVLK L  +Y YG +L  L++D
Sbjct: 1   RILVALSGGKDSLVLLHVLKKLQRRYPYGFELEALTVD 38

Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domainhas a strongly conserved motif SGGKD at the N terminus. Length = 185
>gnl|CDD|238951 cd01993, Alpha_ANH_like_II, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>gnl|CDD|129370 TIGR00269, TIGR00269, TIGR00269 family protein Back     alignment and domain information
>gnl|CDD|223115 COG0037, MesJ, tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223115 COG0037, MesJ, tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238950 cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233864 TIGR02432, lysidine_TilS_N, tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>gnl|CDD|216343 pfam01171, ATP_bind_3, PP-loop family Back     alignment and domain information
>gnl|CDD|238944 cd01986, Alpha_ANH_like, Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 165
TIGR00269104 conserved hypothetical protein TIGR00269. 99.92
PRK10696 258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 99.52
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 99.33
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 99.33
KOG2840|consensus347 99.0
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 98.93
KOG2840|consensus 347 98.88
PRK00074 511 guaA GMP synthase; Reviewed 98.74
TIGR03573 343 WbuX N-acetyl sugar amidotransferase. This enzyme 98.66
PRK00919 307 GMP synthase subunit B; Validated 98.64
PLN02347 536 GMP synthetase 98.59
PRK08576 438 hypothetical protein; Provisional 98.52
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 98.49
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 98.46
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 98.46
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 98.43
PRK02090 241 phosphoadenosine phosphosulfate reductase; Provisi 98.42
COG3969 407 Predicted phosphoadenosine phosphosulfate sulfotra 98.32
PRK08349198 hypothetical protein; Validated 98.29
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 98.25
TIGR00552 250 nadE NAD+ synthetase. NAD+ synthetase is a nearly 98.24
COG0519 315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucle 98.23
KOG1622|consensus 552 98.22
TIGR00342 371 thiazole biosynthesis/tRNA modification protein Th 98.18
PRK13980 265 NAD synthetase; Provisional 98.16
cd00553 248 NAD_synthase NAD+ synthase is a homodimer, which c 98.11
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 98.02
TIGR00884 311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 98.02
PRK13795 636 hypothetical protein; Provisional 97.97
KOG2594|consensus 396 97.96
PRK13794 479 hypothetical protein; Provisional 97.96
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 97.95
PRK08384 381 thiamine biosynthesis protein ThiI; Provisional 97.95
PRK08557 417 hypothetical protein; Provisional 97.94
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 97.91
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 97.89
COG1606 269 ATP-utilizing enzymes of the PP-loop superfamily [ 97.86
PRK00143346 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed 97.85
PRK01565 394 thiamine biosynthesis protein ThiI; Provisional 97.84
PRK01269 482 tRNA s(4)U8 sulfurtransferase; Provisional 97.81
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 97.79
PF10288107 DUF2392: Protein of unknown function (DUF2392); In 97.75
TIGR02057 226 PAPS_reductase phosphoadenosine phosphosulfate red 97.72
PRK02628 679 nadE NAD synthetase; Reviewed 97.6
PRK06850 507 hypothetical protein; Provisional 97.43
PRK00876 326 nadE NAD synthetase; Reviewed 97.32
PF02540 242 NAD_synthase: NAD synthase; InterPro: IPR022310 NA 97.28
PTZ00323 294 NAD+ synthase; Provisional 97.23
COG0175 261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotr 97.13
PF00733 255 Asn_synthase: Asparagine synthase; InterPro: IPR00 97.12
PRK13981 540 NAD synthetase; Provisional 96.83
TIGR01536 467 asn_synth_AEB asparagine synthase (glutamine-hydro 96.81
PRK00768 268 nadE NAD synthetase; Reviewed 96.35
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 95.89
COG1365 255 Predicted ATPase (PP-loop superfamily) [General fu 95.82
COG0171 268 NadE NAD synthase [Coenzyme metabolism] 95.73
PLN02549 578 asparagine synthase (glutamine-hydrolyzing) 95.61
PRK00074511 guaA GMP synthase; Reviewed 95.28
PRK09431 554 asnB asparagine synthetase B; Provisional 95.09
TIGR00420352 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me 95.06
TIGR03104 589 trio_amidotrans asparagine synthase family amidotr 95.04
PTZ00077 586 asparagine synthetase-like protein; Provisional 94.92
KOG0573|consensus 520 94.87
PRK08576438 hypothetical protein; Provisional 94.82
TIGR03108 628 eps_aminotran_1 exosortase 1 system-associated ami 94.79
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthe 94.54
KOG2594|consensus396 94.14
cd01712177 ThiI ThiI is required for thiazole synthesis in th 93.28
TIGR00552250 nadE NAD+ synthetase. NAD+ synthetase is a nearly 93.26
COG0367 542 AsnB Asparagine synthase (glutamine-hydrolyzing) [ 93.04
cd01995169 ExsB ExsB is a transcription regulator related pro 92.89
TIGR00424 463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 92.41
PLN02309 457 5'-adenylylsulfate reductase 91.86
cd01999385 Argininosuccinate_Synthase Argininosuccinate synth 91.77
cd01998349 tRNA_Me_trans tRNA methyl transferase. This family 91.52
PLN02339 700 NAD+ synthase (glutamine-hydrolysing) 91.26
PRK00919307 GMP synthase subunit B; Validated 90.83
COG0301 383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Co 90.8
TIGR00884311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 90.17
PRK14665360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 89.8
PRK05253301 sulfate adenylyltransferase subunit 2; Provisional 89.49
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 88.8
PRK02090241 phosphoadenosine phosphosulfate reductase; Provisi 88.8
PRK08384381 thiamine biosynthesis protein ThiI; Provisional 88.08
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 87.99
PRK14561194 hypothetical protein; Provisional 85.73
TIGR02039294 CysD sulfate adenylyltransferase, small subunit. I 85.13
TIGR00032 394 argG argininosuccinate synthase. argG in bacteria, 84.48
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which c 84.46
COG0794202 GutQ Predicted sugar phosphate isomerase involved 84.07
PRK10490 895 sensor protein KdpD; Provisional 82.99
PRK10499106 PTS system N,N'-diacetylchitobiose-specific transp 80.91
>TIGR00269 conserved hypothetical protein TIGR00269 Back     alignment and domain information 
Probab=99.92  E-value=2.3e-25  Score=159.90  Aligned_cols=91  Identities=33%  Similarity=0.631  Sum_probs=82.1

Q ss_pred             cceeeccCCCCHHHHHHHHHHcCCcceeCCCCCCCCcchHHHHHHHHHHHHhCCchhhHHHHHhhhcccc-----CCCcc
Q psy16399         17 IPRCKPLKYAYEKEIVMYAYYKKLVYFSTECIFAPNAYRGHARTFLKHLEKIRPASIMDIIHSESKYIEK-----NPANF   91 (165)
Q Consensus        17 v~~IRPL~~v~E~ei~~ya~~~~lp~~~~~CP~~~~~~R~~~k~~l~~le~~~P~~k~~i~~a~~~~~~~-----~~~~~   91 (165)
                      ++|||||++++|+||+.||..+|||++.++|||+.+++|.++|++|++||+++||++.+|++|+.++...     ....+
T Consensus         1 v~rIRPL~~v~E~ei~~ya~~~~lp~~~~~CP~~~~a~R~~~k~~L~~LE~~~P~~k~~i~~s~~~~~~~~~~~~~~~~~   80 (104)
T TIGR00269         1 VPRIKPLRYIPEKEVVLYAFLNELKVHLDECPYSSLSVRARIRDFLYDLENKKPGVKFSVLRGFEKLIPLLKELSEQEDL   80 (104)
T ss_pred             CCcccccccCCHHHHHHHHHHcCCCcCCCCCCCCCCCchHHHHHHHHHHHHHCcChHHHHHHHHHHHHHHhhcccccccC
Confidence            5899999999999999999999999999999999999999999999999999999999999999887732     22345


Q ss_pred             cCCC-----CCCccccccchh
Q psy16399         92 NRPK-----TGDTLCKECFFH  107 (165)
Q Consensus        92 ~~c~-----s~~~iCk~C~~~  107 (165)
                      ..|.     |++.+|++|+++
T Consensus        81 ~~C~~CG~pss~~iC~~C~l~  101 (104)
T TIGR00269        81 RRCERCGEPTSGRICKACKFL  101 (104)
T ss_pred             CcCCcCcCcCCccccHhhhhh
Confidence            6665     889999999986

>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>KOG2840|consensus Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2840|consensus Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only] Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1622|consensus Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>KOG2594|consensus Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>PF10288 DUF2392: Protein of unknown function (DUF2392); InterPro: IPR019407 Cytoplasmic thiouridylase is a highly conserved complex responsible for the 2-thiolation of cytosolic tRNAs [] Back     alignment and domain information
>TIGR02057 PAPS_reductase phosphoadenosine phosphosulfate reductase, thioredoxin dependent Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PF02540 NAD_synthase: NAD synthase; InterPro: IPR022310 NAD+ synthase (6 Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF00733 Asn_synthase: Asparagine synthase; InterPro: IPR001962 This domain is always found associated with (IPR000583 from INTERPRO) Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PLN02549 asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>PTZ00077 asparagine synthetase-like protein; Provisional Back     alignment and domain information
>KOG0573|consensus Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>KOG2594|consensus Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>PLN02339 NAD+ synthase (glutamine-hydrolysing) Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>PRK14561 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>COG0794 GutQ Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK10499 PTS system N,N'-diacetylchitobiose-specific transporter subunit IIB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query165
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 1e-08
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 2e-08
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 5e-07
3k32_A 203 Uncharacterized protein MJ0690; predicted subunit 5e-04
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Length = 464 Back     alignment and structure
 Score = 51.6 bits (124), Expect = 1e-08
 Identities = 11/49 (22%), Positives = 23/49 (46%)

Query: 112 EIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLV 160
           ++   I  ++L  +   + +  SGG DS  L HV   L ++++  +   
Sbjct: 4   KVRAFIHRHQLLSEGAAVIVGVSGGPDSLALLHVFLSLRDEWKLQVIAA 52
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Length = 317 Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Length = 433 Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Length = 203 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 99.36
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 99.26
1sur_A 215 PAPS reductase; assimilatory sulfate reduction, 3- 98.95
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 98.81
2o8v_A 252 Phosphoadenosine phosphosulfate reductase; disulfi 98.64
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 98.63
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 98.62
2e18_A 257 NH(3)-dependent NAD(+) synthetase; ligase, structu 98.56
3uow_A 556 GMP synthetase; structural genomics consortium, SG 98.52
2oq2_A 261 Phosphoadenosine phosphosulfate reductase; sulfate 98.5
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 98.48
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 98.48
2wsi_A 306 FAD synthetase; transferase, nucleotidyltransferas 98.43
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 98.42
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 98.42
3p52_A 249 NH(3)-dependent NAD(+) synthetase; structural geno 98.4
1xng_A 268 NH(3)-dependent NAD(+) synthetase; amidotransferas 98.39
2c5s_A 413 THII, probable thiamine biosynthesis protein THII; 98.38
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 98.36
2goy_A 275 Adenosine phosphosulfate reductase; iron sulfur cl 98.21
3fiu_A 249 NH(3)-dependent NAD(+) synthetase; rossman fold, a 98.17
2dpl_A 308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 98.07
2der_A 380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 97.83
3q4g_A 279 NH(3)-dependent NAD(+) synthetase; structural geno 97.79
1kqp_A 271 NAD+ synthase, NH(3)-dependent NAD(+) synthetase, 97.73
1wxi_A 275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, l 97.69
3n05_A 590 NH(3)-dependent NAD(+) synthetase; ligase, structu 97.63
3fwk_A 308 FMN adenylyltransferase; FAD biosynthesis, alpha/b 97.63
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 97.49
3dpi_A 285 NAD+ synthetase; ssgcid, decode, structural genomi 97.48
3sdb_A 680 Glutamine-dependent NAD(+) synthetase; glutamine-a 97.37
1vbk_A307 Hypothetical protein PH1313; structural genomics, 97.27
1q15_A 503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, 96.58
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 96.57
1jgt_A 513 Beta-lactam synthetase; asparagine synthetase, cla 96.49
1ct9_A 553 Asparagine synthetase B; amidotransferase, substra 96.26
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 96.07
3ilv_A 634 Glutamine-dependent NAD(+) synthetase; protein str 95.76
2der_A380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 95.62
2hma_A376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 95.47
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferas 93.89
4f4h_A 565 Glutamine dependent NAD+ synthetase; structural ge 93.71
1kor_A 400 Argininosuccinate synthetase; ligase, riken struct 93.67
3tqi_A527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 93.63
3uow_A556 GMP synthetase; structural genomics consortium, SG 93.2
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 91.91
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 91.82
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structu 90.58
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 90.53
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, 90.49
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cl 90.13
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfi 89.97
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 87.48
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 87.02
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel 86.9
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 86.63
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 86.15
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine ami 85.5
3fg9_A 156 Protein of universal stress protein USPA family; A 84.78
3dlo_A155 Universal stress protein; unknown function, struct 83.06
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferas 82.45
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
Probab=99.36  E-value=6.6e-13  Score=110.17  Aligned_cols=61  Identities=28%  Similarity=0.317  Sum_probs=55.4

Q ss_pred             ccchhhhhHHHHHHHHhccccCCCCEEEEEecCCccHHHHHHHHHHHhhhccCCcc-EEEEEeC
Q psy16399        103 ECFFHAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLD-LVLLSID  165 (165)
Q Consensus       103 ~C~~~~~~~~v~~~i~~~~~~~~~~~vlvavSGG~DS~~Ll~ll~~l~~~~~~~~~-l~~~~vd  165 (165)
                      .|.+..+.++|.+++++++++.++++|+||+|||+||++||+++.++++.  .+++ +.++|||
T Consensus         1 ~~~~~~~~~~~~~~i~~~~l~~~~~~vlva~SGG~DS~~Ll~ll~~~~~~--~g~~~v~av~vd   62 (317)
T 1wy5_A            1 MNPESRVIRKVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNY--FSLKEVALAHFN   62 (317)
T ss_dssp             CCHHHHHHHHHHHHHHHHCSCSSCCEEEEECCSSHHHHHHHHHHHHSTTT--TTCSEEEEEEEE
T ss_pred             CccHHHHHHHHHHHHHHcCCCCCCCEEEEEecchHHHHHHHHHHHHHHHH--cCCCEEEEEEEE
Confidence            37778899999999999999999999999999999999999999988655  5788 9999997
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} SCOP: c.26.2.0 Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>3q4g_A NH(3)-dependent NAD(+) synthetase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 2.40A {Vibrio cholerae} SCOP: c.26.2.0 Back     alignment and structure
>1kqp_A NAD+ synthase, NH(3)-dependent NAD(+) synthetase, SPOR; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei} SCOP: c.26.2.0 Back     alignment and structure
>3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A* Back     alignment and structure
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic AC AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii} Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 165
d1wy5a1 216 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aqui 1e-06
d1ni5a1 227 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, T 1e-06
d1j20a1 165 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N 0.002
d2c5sa1 218 c.26.2.6 (A:174-391) Thiamine biosynthesis protein 0.003
d1vl2a1 168 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N 0.003
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Length = 216 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PP-loop ATPase
domain: TilS-like protein Aq 1887
species: Aquifex aeolicus [TaxId: 63363]

 Score = 44.2 bits (103), Expect = 1e-06
 Identities = 15/42 (35%), Positives = 20/42 (47%)

Query: 112 EIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKY 153
           ++       K+F    R+ IA SGG DS VL  VL  L   +
Sbjct: 10  KVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYF 51
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 227 Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 165 Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Length = 218 Back     information, alignment and structure
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 168 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query165
d1wy5a1 216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 99.42
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 99.07
d1zuna1 211 Sulfate adenylyltransferase subunit 2, CysD {Pseud 98.9
d1gpma1 197 GMP synthetase, central domain {Escherichia coli [ 98.62
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 98.57
d1sura_ 215 Phosphoadenylyl sulphate (PAPS) reductase {Escheri 98.37
d1xnga1 255 NH3-dependent NAD+-synthetase {Helicobacter pylori 97.93
d1jgta1 299 beta-Lactam synthetase {Streptomyces clavuligerus 96.9
d1wxia1 274 NH3-dependent NAD+-synthetase {Escherichia coli [T 96.86
d1q15a1 296 beta-Lactam synthetase {Pectobacterium carotovorum 96.8
d1kqpa_ 271 NH3-dependent NAD+-synthetase {Bacillus subtilis [ 96.76
d1ct9a1 324 Asparagine synthetase B, C-terminal domain {Escher 96.53
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 95.64
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 88.23
d1sura_215 Phosphoadenylyl sulphate (PAPS) reductase {Escheri 82.99
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 82.94
d1iiba_103 Enzyme IIB-cellobiose {Escherichia coli [TaxId: 56 82.49
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PP-loop ATPase
domain: TilS-like protein Aq 1887
species: Aquifex aeolicus [TaxId: 63363]

Probab=99.42  E-value=6.7e-14  Score=108.64  Aligned_cols=58  Identities=28%  Similarity=0.350  Sum_probs=50.3

Q ss_pred             hhhhHHHHHHHHhccccCCCCEEEEEecCCccHHHHHHHHHHHhhhccCCccEEEEEeC
Q psy16399        107 HAFELEIHHTIVTNKLFEKHHRIAIAASGGKDSTVLAHVLKVLNEKYQYGLDLVLLSID  165 (165)
Q Consensus       107 ~~~~~~v~~~i~~~~~~~~~~~vlvavSGG~DS~~Ll~ll~~l~~~~~~~~~l~~~~vd  165 (165)
                      .++.++|.+.+.+++++.++++|+||+|||+||++|||+|.+++...+ ...+.++|||
T Consensus         5 ~~~~~k~~~~~~~~~l~~~~~kv~Va~SGG~DS~~Ll~lL~~~~~~~~-~~~i~~~~vd   62 (216)
T d1wy5a1           5 SRVIRKVLALQNDEKIFSGERRVLIAFSGGVDSVVLTDVLLKLKNYFS-LKEVALAHFN   62 (216)
T ss_dssp             HHHHHHHHHHHHHHCSCSSCCEEEEECCSSHHHHHHHHHHHHSTTTTT-CSEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHhccCCCCeEEEEeCCcHHHHHHHHHHHHHHHhcC-CCcEEEEEee
Confidence            457788999999999999999999999999999999999999876632 2368999986
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1wxia1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ct9a1 c.26.2.1 (A:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1iiba_ c.44.2.1 (A:) Enzyme IIB-cellobiose {Escherichia coli [TaxId: 562]} Back     information, alignment and structure