Diaphorina citri psyllid: psy16400


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MKIPALNSLSGFAFFFPRGVFTAALSTLARFHWLNWDPNPKYVRTTQENQYSCQHCGKRYRWKSTLKRHEVFECGGKEPVHQCPHCDYRAKQSGNLRVHIRKYHTSIELQSPSPAPRKPIVNPMQTQQQASNLSTNQTPVAAAER
ccccccccccccEEECccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHHHHHHccccccccccccccc
*K****NSLSGFAFFFPRGVFTAALSTLARFHWLNWDPNPKYVRTTQENQYSCQHCGKRYRWKSTLKRHEVFECGGKEPVHQCPHCDYRAKQSGNLRVHIRKYHTSIELQSPSPAPR****************************
xxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIPALNSLSGFAFFFPRGVFTAALSTLARFHWLNWDPNPKYVRTTQENQYSCQHCGKRYRWKSTLKRHEVFECGGKEPVHQCPHCDYRAKQSGNLRVHIRKYHTSIELQSPSPAPRKPIVNPMQTQQQASNLSTNQTPVAAAER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Longitudinals lacking protein, isoform G Putative transcription factor required for axon growth and guidance in the central and peripheral nervous systems. Repels CNS axons away from the midline by promoting the expression of the midline repellent sli and its receptor robo.confidentP42283

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DLQ, chain A
Confidence level:very confident
Coverage over the Query: 22-133
View the alignment between query and template
View the model in PyMOL